KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_59268Help
Entry
BRAFLDRAFT_59268  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00600  Sphingolipid metabolism
bfo01100  Metabolic pathways
bfo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BRAFLDRAFT_59268
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    BRAFLDRAFT_59268
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     BRAFLDRAFT_59268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M DUF1080 Glyco_hydro_30 Patatin
Motif
Other DBs
NCBI-GeneID: 7232440
NCBI-ProteinID: XP_002600707
JGI: 59268
UniProt: C3YSL8
AA seq 668 aa AA seqDB search
MASNTKYGSVVCLLVLGVLTTPIASVYTLTDQGGLGARFDGVGGLSGGGATSRLLVSYPE
PYRSQILDYLFKPNFGAALQILKVEIGGDAQSTDGSEPSHMHSADDQNYTRGYEWWLMRE
AKKRNPSIKLYGLPWAFPGWVGGGEAFPYHRPETTANYIVNWILGAKTIHGLTIDYVGIW
NERIHDVTYIKTLRKTLDDNDLGHVMIVAPDGGWVQISKDIMADPELAAAVDIIGSHYPG
THSAPMAQQTGKTLWSSEDYSTYNNGTGASCWARILNQNYVNGHMTSTISWNLIASYYDD
LPFPRAGLMTANQPWSGHYEVSDPIWVTAHTTHFTSPGWQYLKGVGHLDGGGSYVSLTDG
KGGLTIVIEAMTHQYSQCVRPLLPPYDVKSGQVATFQLGGAFENITRLHRWDSKFIGSLA
EHFQKQDDLLVSGGKFSIAVAENCLYTLTTVKEDAPKLYPNPPKSAPFPLPYKAKFDGPA
DSSEAPYFADQTGVFELYVNESSSDHVGTLRQNLTERPIVWCNDADSAISVIGDYNWSNV
SVSCDVMVESGGGAFVAARVDRGGCDVRQARGVFFWLLEDDTYNWIVSSDLSRNHILGQG
KVNATIVGQWHKLTLYAKGDSVAGFLNDGKVLFDITDAQLPTKNGFAAIGTLGFQKVQFD
NFAVDKSK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaacacgaaatacggaagcgtcgtctgccttcttgttcttggtgttctaact
acccccatcgcctcagtctacaccctaacggaccagggcgggttgggggcgaggtttgac
ggggtagggggcctgagcggcggaggggcgacttcgcgcctcctcgtgagctaccccgag
ccgtaccggtcccagatcctagactacctgttcaaacccaacttcggggcggcgctgcag
attctcaaagtggagataggcggagacgctcagagcacggacggcagcgagccgtcgcac
atgcacagcgcagacgaccagaactacacgcgcgggtacgagtggtggctcatgcgggag
gccaagaagcgcaacccgagcatcaagctgtacgggctgccctgggccttcccggggtgg
gtggggggcggggaggccttcccctaccaccgcccggaaacaaccgcaaactacatcgtc
aactggatccttggcgccaaaacgatccacggcctgaccattgactacgtggggatctgg
aacgaaaggattcatgacgtcacctacatcaagacgctgaggaaaacgttggacgacaat
gaccttggtcacgtgatgatcgtggcaccagacggaggctgggtgcagatctcgaaagac
atcatggcggatcctgagctggctgctgctgtggacatcattgggtcccactacccgggt
acgcacagcgcccccatggcgcaacaaaccgggaagaccctctggtcgtcggaagactac
agtacgtacaacaacggcaccggggcctcgtgctgggcgcgaatcctcaaccagaactac
gtcaacggtcacatgaccagcaccatatcctggaacctcatcgcaagctactacgacgac
ttgcccttcccacgggccggtttgatgacagccaaccagccctggagcggtcactacgag
gtcagcgaccccatctgggtgaccgcccacaccacccacttcacctctcccggctggcag
tacctgaaaggcgtcggtcatctggacggcggggggagctatgtgtccttgactgacggg
aagggcggtctgacgatcgtcatagaggctatgactcaccagtattcgcagtgcgtccgc
cccttgcttccgccttacgatgtgaaatcggggcaggtcgcaactttccagttaggcggc
gcttttgaaaacatcacccgccttcatcgatgggactcgaaattcatcggcagcctagct
gaacacttccagaaacaggatgacctattggtgagcggggggaagttttcaatagcagtg
gcggagaactgtctgtacaccctgacaactgtgaaggaggatgcgcccaaactgtacccg
aaccctcccaagtcggcaccgttcccgctcccatataaggcaaagtttgatggcccggcg
gactccagtgaggcgccgtattttgccgatcagacaggagttttcgagctgtacgtgaat
gagagcagctcggatcacgtcggcacgctgaggcagaacctgacggagaggcccatcgtg
tggtgcaacgatgctgactcggcaatcagtgtcatcggcgactacaactggtccaacgtc
agcgtcagctgcgatgtcatggtggaatcgggaggcggcgcttttgtcgccgcacgggtg
gaccgtggcggctgtgacgtcaggcaagccaggggtgttttcttctggcttctcgaagac
gatacttacaactggattgtttcttcagaccttagcaggaatcacatcttaggacagggt
aaagtcaatgctactatagttggccagtggcacaagctaaccctttacgcaaagggagac
agtgtagccgggtttctaaacgatgggaaagttttgttcgatattaccgacgctcaactc
cccaccaagaacggtttcgctgctataggtactcttggctttcagaaagttcagtttgac
aattttgcagtggataaatcaaaatag

DBGET integrated database retrieval system