KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_59343Help
Entry
BRAFLDRAFT_59343  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K09290  tropomyosin 3
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Cytoskeleton proteins [BR:bfo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     BRAFLDRAFT_59343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II Golgin_A5 DUF1664 XhlA DUF724 CLZ Reo_sigmaC IncA BST2 TMF_DNA_bd ATG16 DUF3450 Fez1 CREPT Rogdi_lz HrpB7 MscS_porin SesA GAS Spc7 SlyX DUF4472 FlxA DUF745 Lebercilin TMPIT Fib_alpha AAA_13 RmuC MAD
Motif
Other DBs
NCBI-GeneID: 7233936
NCBI-ProteinID: XP_002606251
JGI: 59343
UniProt: C3YBA4
AA seq 284 aa AA seqDB search
MDAIKKKMLMLKNDKENALDRAEQAEQAMKDAQEKNVKLEDEINDLNKKIRMVEDELDKA
QESLKDATEQLEAATKKAADAEAEVASLNRRIQLVEEELDRAQERLNSTVEKLTDSEKAA
DESERARKVLENRGAADEDRMELLDMQLREAKMIAEEADRKYEEVARKLVITEGDLERAE
ERADLAETKAAELEEELKNVTNQLKSLEAAADKASEKEEAYEEQVRDLSAKLKEAETRAE
FAERTVAKLEKNVDDLEDELYAEKLKFKGISEELDHTLNDLSTF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaagaagatgttgatgttgaagaacgacaaggagaacgccctggac
agggctgagcaagccgagcaggctatgaaggatgctcaggagaagaacgtcaaattggaa
gatgagatcaacgatctgaacaagaagatcaggatggttgaggatgagttggacaaggcc
caggagtccctgaaggacgctaccgagcagctggaggcagccaccaagaaggccgcagat
gctgaggcagaagtggcatctctgaacaggcgtatccagctggtagaggaggagttggac
cgtgcccaggagcgcctgaactccactgtcgagaaactgacagactctgagaaggctgct
gatgagagcgagagagcaaggaaggtattggaaaacagaggtgcggcagatgaggatcgg
atggagctgctggacatgcagctgagggaggccaagatgattgcagaggaggctgaccgc
aagtatgaggaggtggcccgtaagctggtgatcactgagggcgacctggagcgtgctgag
gagcgcgccgacttggcagaaactaaagcagctgagctggaagaagagttgaaaaatgtg
acaaaccagctcaaatccctggaagctgctgcagacaaggcttcagagaaggaagaggct
tatgaggagcaggtccgcgacctgtcagccaagctcaaggaggctgagacccgtgcagaa
ttcgcagagaggacagttgcgaagctggagaagaacgtggatgaccttgaagacgaactc
tatgccgagaagctcaaattcaagggcatcagcgaagagttggaccacactctcaacgat
ctctccactttctaa

DBGET integrated database retrieval system