KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_60037Help
Entry
BRAFLDRAFT_60037  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04068  FoxO signaling pathway
bfo04140  Autophagy - animal
bfo04150  mTOR signaling pathway
bfo04350  TGF-beta signaling pathway
bfo04933  AGE-RAGE signaling pathway in diabetic complications
Module
bfo_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    BRAFLDRAFT_60037
   04068 FoxO signaling pathway
    BRAFLDRAFT_60037
   04150 mTOR signaling pathway
    BRAFLDRAFT_60037
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    BRAFLDRAFT_60037
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    BRAFLDRAFT_60037
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     BRAFLDRAFT_60037
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   BRAFLDRAFT_60037
Chromosome and associated proteins [BR:bfo03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     BRAFLDRAFT_60037
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_60037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kdo Choline_kinase NDUF_B4
Motif
Other DBs
NCBI-GeneID: 7205968
NCBI-ProteinID: XP_002590700
JGI: 60037
UniProt: C3ZL29
AA seq 303 aa AA seqDB search
MAEGAGRPNVEVVRGQTFEVGPRYSGLQYIGEGAYGMVCSAVDQTTGKRIAIKKISPFEH
QTYCQRTLREIKILRRFKHENVIGIENIIRSASIDEMKDVGSYIVQCLMETDLYKLLKTQ
QLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHD
HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLNNRPIFPGKHYLDQISH
ILGVRITVEEALAHEYLSQYYDPDDEPVASEPFKFDTELDDLPKEKLKEMIWEETKFFSH
QHK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggagctggcagaccgaatgtggaggttgtccgcgggcagactttcgaggtc
gggcctcgctacagcggcctgcagtacatcggggaaggcgcctacgggatggtctgctct
gcagtggaccagaccacagggaaacgcatcgccattaagaagatcagtcccttcgagcac
cagacgtactgtcagaggacgctacgcgagatcaagatcctcagaaggtttaaacatgag
aacgtgattggcattgagaacatcatcagatcagcctccatcgatgagatgaaggacgtt
ggcagctacattgtgcagtgtctgatggagacagacttgtacaaactgctgaagacacag
cagctcagcaacgatcacgtctgctacttcctgtatcagatcctgcggggactcaagtac
atccactctgcaaatgtgctgcacagagacctcaaaccctccaacctactgctcaacacc
acctgtgatcttaagatctgtgactttgggctggcgcgcgtggcggacccggagcacgat
cacaccggcttcctgacggagtatgtcgccaccaggtggtaccgggcacccgagatcatg
ctcaactccaagggttacaccaagtccattgacatctggtctgtgggctgtatcctggcc
gagatgctgaacaacaggcccatctttcctggcaagcactatctggaccagatcagccat
attttaggagtgcgcatcacagtggaggaggcactcgcccacgagtacctgtcccagtac
tacgacccggacgacgagccggtggcctctgagcccttcaagttcgacacagagctggat
gatctgcctaaggagaagttgaaagaaatgatctgggaggagacgaagtttttcagccac
caacacaagtga

DBGET integrated database retrieval system