KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_60037Help
Entry
BRAFLDRAFT_60037  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    BRAFLDRAFT_60037
   04068 FoxO signaling pathway
    BRAFLDRAFT_60037
   04150 mTOR signaling pathway
    BRAFLDRAFT_60037
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    BRAFLDRAFT_60037
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     BRAFLDRAFT_60037
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   BRAFLDRAFT_60037
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_60037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 303 aa AA seqDB search
MAEGAGRPNVEVVRGQTFEVGPRYSGLQYIGEGAYGMVCSAVDQTTGKRIAIKKISPFEH
QTYCQRTLREIKILRRFKHENVIGIENIIRSASIDEMKDVGSYIVQCLMETDLYKLLKTQ
QLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHD
HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLNNRPIFPGKHYLDQISH
ILGVRITVEEALAHEYLSQYYDPDDEPVASEPFKFDTELDDLPKEKLKEMIWEETKFFSH
QHK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggagctggcagaccgaatgtggaggttgtccgcgggcagactttcgaggtc
gggcctcgctacagcggcctgcagtacatcggggaaggcgcctacgggatggtctgctct
gcagtggaccagaccacagggaaacgcatcgccattaagaagatcagtcccttcgagcac
cagacgtactgtcagaggacgctacgcgagatcaagatcctcagaaggtttaaacatgag
aacgtgattggcattgagaacatcatcagatcagcctccatcgatgagatgaaggacgtt
ggcagctacattgtgcagtgtctgatggagacagacttgtacaaactgctgaagacacag
cagctcagcaacgatcacgtctgctacttcctgtatcagatcctgcggggactcaagtac
atccactctgcaaatgtgctgcacagagacctcaaaccctccaacctactgctcaacacc
acctgtgatcttaagatctgtgactttgggctggcgcgcgtggcggacccggagcacgat
cacaccggcttcctgacggagtatgtcgccaccaggtggtaccgggcacccgagatcatg
ctcaactccaagggttacaccaagtccattgacatctggtctgtgggctgtatcctggcc
gagatgctgaacaacaggcccatctttcctggcaagcactatctggaccagatcagccat
attttaggagtgcgcatcacagtggaggaggcactcgcccacgagtacctgtcccagtac
tacgacccggacgacgagccggtggcctctgagcccttcaagttcgacacagagctggat
gatctgcctaaggagaagttgaaagaaatgatctgggaggagacgaagtttttcagccac
caacacaagtga

DBGET integrated database retrieval system