KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_60136Help
Entry
BRAFLDRAFT_60136  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    BRAFLDRAFT_60136
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     BRAFLDRAFT_60136
Glycosyltransferases [BR:bfo01003]
 Glycan extension
  Type 3 chain
   BRAFLDRAFT_60136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 356 aa AA seqDB search
MAAGVTKNSLVTFALGIFFGFGISYVFVNYISTPSHGPGPPDRRAIESNEVEVAKQPYDH
PEVNLSDSPRKALEWTDLDDAHHKGQDKEAQELYDNVRVLCWVMTQPDNLDKKAKHVKAT
WAKRCNKILYMSSNAEPNFPVIGLGTGEGRDKLWAKTKAAYEYIYKNHIDDADWFMKADD
DTFVVVENLRYMLKDYDPTEAVYFGRRFKPFVKQGYMSGGAGYVLSKEAVKKFVEGNCKA
RSIMEDVEMGRCMEQVGVRAEDSRDKLGRERFHPFVPEHHLIPGRVPKGNWYWKYQFYTA
HDGPDCCSDYAISFHYVSPANMYVLEYMTYHLRPFGYNYTPPIDLNRPRTKIPPPQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggggtgacgaaaaactcccttgtcaccttcgccttgggtattttcttcggt
ttcgggatatcctacgtctttgtgaactatatttcgacaccatcgcatggtcccggtcct
cccgatcgaagagccatcgagagcaacgaggtagaagtggcgaaacagccgtacgaccac
ccggaagtgaacctttctgactcgccgcgcaaggcgctagagtggaccgacttggacgat
gcccaccacaaaggccaagacaaggaagctcaggagttgtacgacaatgttcgcgtgctt
tgctgggtcatgacgcaacccgacaacctcgacaagaaggccaaacacgtgaaggccacg
tgggccaaacgctgcaacaaaatcctttacatgagctccaacgccgagcccaactttccc
gtcatcggcctcggaacgggggagggccgcgacaaactctgggcgaaaacgaaagccgcg
tacgagtacatatacaagaaccacatagacgatgcagactggttcatgaaggctgacgac
gacacgttcgtcgtggtagaaaacttgagatacatgctgaaagactacgaccccaccgag
gcggtctacttcggtcggcgcttcaaaccgtttgtcaaacagggctacatgagcggcggc
gccggctacgtcctcagcaaggaagcggtgaagaaattcgtggaggggaactgtaaagcg
cggtccatcatggaggacgtggagatggggagatgtatggagcaggtcggggtacgagcg
gaggactcgcgagataaactaggtcgcgagagattccaccccttcgtgccagagcaccac
ctcattccagggagagtaccaaaagggaactggtactggaagtatcagttttacacagcc
catgacggaccagactgctgttcggactatgccatctctttccactatgtgtccccagct
aatatgtatgtgctggagtatatgacgtatcatctcaggccatttggatacaactacact
cccccaatcgatctcaacagaccaagaacaaaaatccctcctccccaataa

DBGET integrated database retrieval system