KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_61299Help
Entry
BRAFLDRAFT_61299  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BRAFLDRAFT_61299
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   BRAFLDRAFT_61299
Protein phosphatases and associated proteins [BR:bfo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BRAFLDRAFT_61299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 282 aa AA seqDB search
MKSWKLEDFDIGRPLGKGKFGNVYLAREKNSKFIVALKVLFKSQLMKAGVEHQLRREIEI
QSHLRHPHILRLYGYFYDDTRVYLILEYAPRGELYKELQKQVRFDERRSATYIAQLADAL
KYCHSKKVIHRDIKPENLLLGLKGDLKIADFGWSVHAPSSRRATLCGTLDYLPPEMIEGK
MHDEKVDLWSLGVLCYEFLVGKPPFEAEGHSETYRRISKVDLRFPPHVTSGARDLISKLL
RHNPMLRLPLDSVLSHPWIKDNAATQAESTPAHPTHASHTKS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttggaagctggaagattttgacatcggccggccgctgggcaagggcaagttc
gggaacgtttatctggcgagagagaaaaactccaagttcatcgtagcactgaaggttctg
ttcaagtcccagctgatgaaggcaggtgtcgaacaccagctgcggcgggagatagagatc
cagtctcacctcagacacccccacatcctgcggctgtacgggtatttctacgacgacacg
cgggtttacctgatcctggagtacgccccgcgtggcgagctgtacaaggaactacagaag
caagtccgcttcgacgagagaagatccgccacgtacatcgcccagctggcggatgcactg
aagtactgccactctaagaaagtgatccaccgagacatcaagccggagaacctgctgctg
ggtctgaagggagacctgaagatcgcagacttcggctggtcggtccacgcgccctcctca
agacgtgcgacgctgtgcggaacgctggactacctccctccggagatgattgaagggaag
atgcacgatgagaaagtcgacctgtggagtctgggcgtgctctgctacgagttcctggtg
ggcaagccgcccttcgaggccgagggccacagcgaaacctacagacggatatcaaaggtt
gacctgagatttccgccccacgtgacctctggagcacgagatttgatatcaaagctgctg
cgccacaacccaatgctgcggctgccactggacagcgttctcagccacccctggataaag
gacaacgcagccacgcaggccgagtccacacccgcacaccccacacacgcctcccacacc
aagtcatga

DBGET integrated database retrieval system