KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_61689Help
Entry
BRAFLDRAFT_61689  CDS       T01074                                 

Gene name
gamt1
Definition
guanidinoacetate methyltransferase protein
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bfo00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bfo00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 236 aa AA seqDB search
MTAIEGEPVFGSGEDCKPAWTDAPADYDTTDEHLSIMGKPVMERWQTPYMHKLAKVASCN
GGRVLEIGFGMAIASSEIQRHKIDEHWIIECNDGVFKRLQQWVREQKHKIFPIKGMWQDV
VPTLPDGHFDGILYDTYPLSEAEWHTHQFDFIGKHACRLLKPGGVLTYCNLTSWGELLEN
KYDNIETMFKETQIPYLEKAGFQKKNISWEVISNQPPKDSRKYKFPLMLAPKCIKT
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatagagggtgagcctgtgtttggatccggagaagactgcaagccagcatgg
acagacgccccggcggactacgatacgacggacgagcacctgtcaatcatggggaaaccc
gtcatggaacggtggcagacgccttacatgcacaaactggctaaagtcgccagctgcaac
ggtggccgtgtccttgaaatcggatttggcatggccattgccagcagcgagattcagcgg
cacaaaatcgatgaacactggatcattgaatgtaacgacggtgtgttcaagagactacaa
cagtgggtcagggaacagaagcacaagattttcccaataaagggcatgtggcaggatgtt
gtcccaactctacccgatggacattttgatggcattttgtacgacacgtaccccctgtct
gaggcggagtggcacacccaccagtttgacttcatcgggaagcacgcctgccggttactg
aagccaggcggagttctgacctactgtaacctaacttcatggggtgaactactagaaaac
aagtacgacaacattgaaaccatgtttaaagagacccagatcccttaccttgagaaagca
ggtttccagaaaaagaacatctcatgggaggtcatctctaaccagccgccaaaagactca
cgaaagtacaagttcccacttatgcttgcacctaagtgtattaagacttaa

DBGET integrated database retrieval system