KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_62571Help
Entry
BRAFLDRAFT_62571  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BRAFLDRAFT_62571
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     BRAFLDRAFT_62571
Peptidases [BR:bfo01002]
 Serine Peptidases
  Family S33
   BRAFLDRAFT_62571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
AA seq 306 aa AA seqDB search
MSGDSGTSVDGPKTPQGVFYTKLPHLVNSTGQYLFCKYWEPQEQEPRALLMIVHGVAEHC
QRYEELATELNKEGVLVFAHDHVGHGQSQGHPADIKSFDEYVQDVLQHADKMRAAHPGIP
LFVFGHSMGGAIATLAAMERHTLFAGVVLSAPAIIPSPETATTFRVFAAKMLASIVPRFE
VGKVDTSFVSRDPAKVKAYEDDPLIYHGGLRARWAVQILGAMDQIRQRVSTFQSPLLALH
GDQDKLSLPEGSQFLYDNAPVTDKQIKIYPGFYHELLNEPQPDAETVRTDIVTWVTERIE
SESVQH
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgattccggaactagcgtggacggcccgaagactccacagggcgttttctac
accaagttgccccacctggtgaactctacgggacagtatctattctgcaagtactgggaa
ccacaagagcaagaaccaagggctctgttgatgattgtccatggagtcgccgaacactgt
cagagatatgaagaactcgcaacagaactgaacaaagagggagtactggtttttgcacac
gatcatgtcgggcacggccagagccagggtcaccctgctgacatcaagagttttgacgag
tacgttcaggacgtgttgcagcacgccgacaagatgcgagccgcgcaccccgggattccg
ctcttcgtattcggacactccatgggaggagcaattgccaccctagcggcaatggaacgg
cacactctatttgcaggggtggtgctatcggcccctgccatcattccttcgccagaaaca
gccactacattcagggtgtttgctgccaagatgctggcttctatcgtaccgaggtttgaa
gttgggaaagtggatacaagtttcgtcagccgggacccggccaaggtgaaagcctacgaa
gacgaccctctgatataccacgggggcctgcgtgctcgctgggcggtgcagatattaggc
gctatggaccagatccggcagcgggtctccaccttccagtcaccgctactagccctgcat
ggcgaccaggacaaactctcccttcccgagggatcccagttcctgtacgacaacgcccca
gtaacggataaacagattaagatctatcccggtttctaccacgagcttctgaacgagccg
cagcctgacgccgagacggtacggacagacatcgtgacttgggtaacggagcggatagag
agcgagagcgtccaacattga

DBGET integrated database retrieval system