KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_62801Help
Entry
BRAFLDRAFT_62801  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BRAFLDRAFT_62801
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BRAFLDRAFT_62801
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BRAFLDRAFT_62801
Lipid biosynthesis proteins [BR:bfo01004]
 Desaturase
  First
   BRAFLDRAFT_62801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 323 aa AA seqDB search
MAPTETSRVRTPKQSSNGAGIPQPRAQPLQIVWRNVVFMTLLHIGAVYGLVLIPHAHTYT
TVWAIFLHYFSGVLGITAGAHRLWTHRSYKARLPLRVVMAAANSVAFQNHIHEWSRDHRC
HHKYSETDADPHNASRGFFFSHCGWLLLRKHPDVKAKGKLIDMTDLAADPVVRFQKRYYL
ASVLLLCFALPTAVPILAWQESLRNAFFIAVVSRYVLTLNVTWLVNSAAHLWGNRPYDRS
IHPAENGFVSAMAGGEGWHNYHHTFPFDYATGELGWRINMTTVFIDAMAWTGLAYDLRTA
SPNVVRARALRTGDGTWKGEHAH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctaccgagaccagcagggtgcgtacacccaagcagtcctcgaacggcgctgga
ataccacagcctcgtgcccaaccactacagatcgtctggaggaatgtggtcttcatgact
cttctccacatcggggcggtgtatgggctggtcctcatacctcatgcccatacatacaca
accgtgtgggcgatcttccttcactacttcagcggggtgctgggcatcacggccggggca
caccgactgtggacacaccggagctacaaggctaggctcccgctcagggtggtcatggca
gcggctaactctgtagcattccagaatcatattcacgagtggtcacgtgaccaccggtgt
catcacaagtactccgagacagatgccgacccccacaatgcctcgcgcggcttcttcttc
tcgcactgtggttggctcctcctcagaaagcacccggatgtcaaggccaaggggaaactg
atcgacatgaccgacttggcggctgaccctgtcgtcagatttcagaaaaggtactacctg
gcgtctgtcctgctgctgtgcttcgccctccccacggccgtcccgatcctggcctggcag
gagagcctgagaaacgccttcttcatcgccgtggtgtcacgttacgtcttgacgctgaac
gtcacctggctggtgaacagcgcagcgcacctgtggggaaaccgcccgtacgaccggtcc
atccacccggccgagaacggcttcgtgtccgctatggccggcggtgaaggctggcacaac
taccaccacaccttccccttcgactacgccaccggtgagctgggatggagaatcaacatg
accacggtgttcatagacgccatggcgtggacgggcctggcgtacgatctcaggaccgcg
tcaccgaacgtcgtcagggcacgggcgttacggacaggggacgggacctggaagggggag
catgcgcactga

DBGET integrated database retrieval system