KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_63636Help
Entry
BRAFLDRAFT_63636  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BRAFLDRAFT_63636
Transcription factors [BR:bfo03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    BRAFLDRAFT_63636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1410 aa AA seqDB search
MFLQHSFTVSVQHGGGLLTSRSRDENSIKLAEEGQSTRDCDTYSHRYILDCVEKNTLLPL
EQYNRQKFLRSEQINILKYVAEHSDPTRPVGGNKIWKEMALYKITKHSWHAMRDHYLKHL
KGKEHLYQLSDRLKYSRIQFRKDASPTTDDDGDKDAPRDAEEHQSEHSNKDDSINIDMFN
SSDEEEKESGDPTEPTEVSSAQGSSAQATSAQGSSAKMTTAQATSTQGTSAKTTSAQATS
AQATSSQASSAQASSAQATSAKVNSAQLTSAQVDSTLASTTLRRSPLKRRGKVTPVEEKT
QGACGRSDGAGVQKESHEVPASSDDMDDHLAVLAVDVKKKQVKEEAILPEKRARLNPNDG
KNGDIQDVKQDKHQQVGSDAVQEPASAAEAQEELREEDGMLEDEPRGDEEDEDHLLTVLE
GCVKIKELMTEFSLSLLMVTRALYYHRGDVGATRTFLRTGKKTHEKRIQRVLDFNNAANF
IVTNLKIIDSITRCYDEGNLHSPLKWDDESSFMYDDMEEDEKDRNKSKKACNMAMEGSHR
VAQVYHDFRLEQSSWRKKMEESAGWVPGYLAHDMVFQTYYVSAYELERQSRNRSEKKRRD
QFNILINELCSMVSSNNRKMDKSSVLQSTIAFLKRNKEITAQSEANEIKENWKPPFLTNE
EFSQLMLDATNGFMLAINKQGKILYVSENVTSLLGHLPNDLVGNTLGDMVHEKEKVQTCN
LLTHHTLHLDQTESDYGHDKHLSFSCHFVRGKIDPTEEPAYECIKLSGSYRRSLSGKISS
TCKVEKDNQKTKGGVGGSGGDEVVLVMTAKLLAPLFLKEMSVVDETKREFTSRHSLEWKF
LFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLDRISICHEQLMQCGEGTSCCYRFLTKGQ
QWIWLQTRYYITYNQWNSKPEFIVCTHTVVSYSEVCNKLRQELGLSDSGDNVDMSVSFGT
LKRSLSNSSLAVSEKSRKSQRSSAPDRSPHGSAEMHSVQVGETTPGSVQGEDFPDITKQY
KTLNDLLTTKTRPVSSHSSSTSVQQPSNPSQRPQPSSSHHSAPQTVPSAAQSSLAKFSQY
RVADEISSTGTLTENDAMTTMSESVYHSPPSEMPMGALIRPPQLRLQEQLLQRHQALQDT
IRRQQEELQLLRQQILMQCPMVTDPGVLTAMSVQQNSLPYPPSSSLPTPAMPYPPSQAAP
MTNSMQQVPQASLLTSQSNMANMPGGVFVQGQMSSILQAPPQGGQYGAGQVHAMGIIQGQ
FVASQGVQPGPSSSGLASQMDNVSRFDFGQNKTSVVTNPTSKGSLMTTAQLLSPQVHMMP
PPQSPTGVPAPGPAAQTSKSSRPLTVAQRLQMQQQQRLQQANLQSQVQQQPQQQQQQQQQ
QAQLAAANFPYYIHQMYQRQDSDTHSQHSQ
NT seq 4233 nt NT seq  +upstreamnt  +downstreamnt
atgttcctacaacattcctttactgtttctgtgcagcacggaggtggattattaaccagt
agatcccgagacgaaaattccatcaaactcgcagaagaagggcagtcaacgagagattgt
gacacttactcccacagatatattctggactgtgtggagaagaacaccttactaccattg
gaacagtataatcgccagaagttcctgaggagtgaacaaataaatatacttaagtatgta
gcagagcactctgacccaaccagaccagtgggtggcaacaaaatatggaaggaaatggcg
ctgtataagataacgaagcactcctggcatgccatgagagaccattacctgaaacacctc
aagggcaaagagcacctctatcagttgagtgacagattaaagtactcaagaatccagttc
aggaaggacgcaagtccaaccacagatgatgatggtgataaagatgcaccacgggatgca
gaggagcaccaaagtgaacactccaacaaagatgacagcatcaacatagacatgtttaac
tcctctgatgaggaggagaaggaatctggtgaccctacagagcctacagaagtgagttcc
gcacaagggagttccgcacaagcgacttctgcacaagggagttctgcaaaaatgactact
gcacaagcgacttccacacaagggacttctgcaaaaacgacttctgcacaagcgacttct
gcacaagcaacttcttcacaagcgagttctgcacaagcgagttctgcacaagcgacttct
gcaaaagtgaattctgcgcaattgacttctgctcaagtggattccacgctggccagcaca
actctcagaagaagccccctgaaacgacgagggaaagtcaccccagtggaagagaagaca
caaggtgcctgtggaagaagtgatggggctggagtacagaaagaatcccatgaggtgcca
gccagcagtgatgacatggatgaccacctggcagtcctagcagttgacgtgaagaagaaa
caggtaaaagaagaggctatcctgccagaaaagagagcccgacttaacccaaacgatgga
aagaatggggacattcaggatgtgaagcaggacaaacatcaacaagtgggttctgatgct
gtacaggaaccagcaagtgctgcagaagcacaggaggaactgagagaggaggatggaatg
ttggaagatgagcccaggggggatgaagaggatgaagatcacttgctgactgtcctggaa
ggatgtgtaaaaatcaaggagttaatgactgagttcagcctgtccctcctgatggtcaca
cgtgcgctgtactaccaccgcggggatgtgggtgccacaagaacattcctccgcaccggc
aagaaaactcacgagaaaagaatacagcgagtccttgatttcaacaatgctgcaaatttt
attgtcacaaatttaaaaataattgacagtatcaccaggtgctatgacgagggcaacctg
catagccccctcaagtgggatgatgaatcttccttcatgtatgatgacatggaagaagat
gaaaaggacagaaacaaaagcaaaaaggcatgtaacatggcaatggagggaagccacagg
gtagcccaggtgtatcatgacttcagactggaacaaagtagctggaggaagaagatggag
gagtcggcaggctgggttcccgggtacctggcacatgacatggtgtttcagacctactat
gtttcagcatacgagttggagaggcaatcccgtaaccgcagtgagaagaagcgcagagat
cagttcaacattctcatcaacgaactgtgcagtatggtgtctagcaacaaccgcaaaatg
gacaagtcttctgtgctgcagtccacaatcgcatttcttaaaagaaataaagagatcaca
gcgcagagtgaagccaacgagatcaaggagaactggaagcctcctttcctcaccaatgag
gagttttctcagcttatgctggatgcaacaaatggctttatgctggcgatcaacaagcag
ggcaagatcctttatgtctcggaaaatgtcacctccttgcttgggcacttaccgaatgac
cttgttggcaacacgctgggtgacatggttcatgagaaggaaaaggtgcagacttgtaac
ctgctgacgcatcacactctgcacctggaccagacagaatcagactatggacatgacaag
cacctgtccttcagctgccacttcgtgcgagggaagatcgaccctacggaggagccggcc
tacgagtgcatcaagctgtcaggcagctacaggaggtccctgtctggtaaaatcagctcc
acgtgtaaagttgaaaaggacaaccagaagacgaaaggcggcgtgggtgggtcaggggga
gacgaggtggtgctggtcatgacagccaagctgctggccccgctgttcctgaaggagatg
tctgtcgtggacgagaccaagagagagttcacgtccaggcacagtctggagtggaagttt
ctgttcctggaccacagagcacccccgatcattggctaccttccatttgaagtgctgggg
acatctggctatgactactaccacgtggatgacttggacagaatatctatttgccacgag
cagttaatgcagtgtggagaagggacatcctgctgttatcgtttcctgaccaaggggcag
cagtggatctggctacagactagatactacatcacctacaaccagtggaactccaaacct
gagtttatcgtctgcacccacactgttgtcagctactcagaggtgtgcaacaaactgcgt
caggagttgggtctgtctgactctggagacaatgtggacatgtccgtgagcttcggcacc
ctgaagagatccctctccaattcttcattagctgtgtctgaaaagtcaaggaagtcccag
agatcctctgctcctgaccggtccccacatgggtctgcagagatgcattctgttcaggtg
ggtgaaaccactcctggcagcgtgcagggggaggacttccctgacatcaccaaacagtac
aagactctgaacgacctgctgaccaccaagactaggccggtatccagccattctagcagc
acctcagtacagcagcccagcaacccttcgcagcggccccagcccagcagctctcaccac
tccgcccctcagacggtgccgtccgccgcccagtccagcctcgccaagttcagccagtac
cgcgtggcagacgagatcagcagcaccggcacgctgaccgagaacgacgccatgacaacc
atgtcggagagtgtctaccattcccctcctagtgagatgcccatgggagctctcatcaga
ccacctcagctcaggctgcaggaacaactgctgcaaagacatcaggctcttcaggacacg
atccgtcggcagcaggaggagctgcagctgctgcggcagcagatcctgatgcagtgtccc
atggtgacggatcccggagtgctgacggccatgtcggtacaacagaacagcctgccgtac
cccccctcctcgtccctccccacccctgccatgccctaccccccctcccaggccgccccc
atgaccaactccatgcagcaggtcccgcaggcctccctgctgacctcccagtccaacatg
gccaacatgcccgggggggtgttcgtacaggggcagatgtcgtccatcctgcaggcccct
ccccaggggggtcagtacggggcggggcaggtccacgccatgggcatcatacagggacag
tttgtggcttcccaaggcgtgcagccggggccatcctcctccggtctggcctcccaaatg
gacaatgtcagtagatttgatttcggacagaataagacttcagttgttacaaatccgacg
agtaaaggttctctgatgaccacagcccagctcctgtcaccgcaggtccacatgatgcca
cctcctcagtcccccacgggcgtgcctgcccccggccccgccgcgcagaccagcaagagc
agccggccgctcactgtggcacagagactgcagatgcagcagcagcaaaggctgcagcag
gcaaacctgcagtcacaggtacaacaacagccacaacaacaacaacaacaacaacaacaa
caagcacagctggccgctgcaaacttcccatactacatccatcaaatgtaccagaggcag
gactcggacacacacagccagcactcccagtga

DBGET integrated database retrieval system