KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_63761Help
Entry
BRAFLDRAFT_63761  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BRAFLDRAFT_63761
   00053 Ascorbate and aldarate metabolism
    BRAFLDRAFT_63761
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    BRAFLDRAFT_63761
   00860 Porphyrin and chlorophyll metabolism
    BRAFLDRAFT_63761
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    BRAFLDRAFT_63761
   00982 Drug metabolism - cytochrome P450
    BRAFLDRAFT_63761
   00983 Drug metabolism - other enzymes
    BRAFLDRAFT_63761
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     BRAFLDRAFT_63761
Glycosyltransferases [BR:bfo01003]
 Others
  Hydrophobic molecule
   BRAFLDRAFT_63761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
AA seq 818 aa AA seqDB search
MGIGPKLRCATLLLVFLGFLIRHRSSAEKVLLVHPTFYNSHWMNMAKIGRALVDKGHTVT
VVVSEDIVEKRRAEWPDFQFEVFQDQGTQTRLREDHAHTTARTMSHLELIEEFVPGEGDL
IKHCDLLLGDSKLEHRLRTSQYSVVISDHVFPCGAILSAHLDVRVPHIAVMRGDPLFLDE
TSTGVPVPPSYVPSLVTDFTDDMTFGQRVQNAIVSTLLPVLARRAAGSRYDGLVRSYVSE
EETIQSVTSRTDLWLYRTDNVLDFPRPSMPNMVQVGGLNVRVVAPLTEIKRSNMGIGPKL
RSSTILLVFLGFLIRSSAEKVLMVPPPCYHSHWMTLAKLGRALVDKGHTVTVVASEDIVE
KRRAEWPDFQFEAFQDQGTQARIMELQDKAYSLVEILSVFEMREEIVAEFGELIKHCDLL
LGDGKLQNRLRTSQYSVVITDPIFDCGAILSAHLDAPHVAVLRGDPFLDETSTGVPIPPS
YVPSLGTDFTDDMTFGQRVQNVALSTFLSVVTRQDLSRAFDGLVRTYVGENETIQSVTSR
TDLWLYRTDNVLDFPRPRMPNMVQVGGLNVLEAAPLAEDMEAFVQSSGDDGMIVVSFGSM
FKTMSTEKQEVFAAAFARLRQKVVWRYVGEKPTGLGNNTKLLAWLPQNDLLAHPKTRAFI
THAGSNGLYEALHHGVPMVCLPLFSDQPANAARVVARGLGVKLDFSTVTSDQLYQAVLHV
VTNTSYRETAARLSRLHRDQPQSPMERAVWWIEHVIKHGRLPHLRARAVELPWYQYYLLD
VSAFLLAVCAAVLGTVWYSCSFFCRKICCKSVGKLKSQ
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggggattggaccgaagcttcgatgtgccactcttctgctagttttcctgggttttctg
atcagacacaggagcagcgcagagaaggttctgttggtacatccaacattttacaacagc
cactggatgaatatggccaaaatcggccgtgctttggtggataaaggtcataccgtcact
gtggttgtttcagaggacattgtagaaaaacgacgggcagagtggcctgactttcagttt
gaggtattccaagaccaaggaacccaaacaaggctcagggaagaccacgctcacactacg
gctaggacaatgtctcacttggaactgatagaagaattcgtccctggggaaggagatttg
ataaaacactgcgacctgcttctgggtgacagtaagctggagcatcgactgaggacatcc
cagtacagtgtggtaatttctgatcacgtgtttccctgcggcgctatcctctcagcccat
ctagacgttcgggtccctcacatcgccgtcatgcgcggagatcctttatttcttgacgaa
acatcaacaggtgtaccggtccctccgtcgtacgtaccatctcttgtaaccgattttacc
gatgatatgacctttggacaacgagtgcagaacgctatcgtatctactcttctcccagtg
ctggcacgccgggctgcgggtagcagatatgacggactggtccgttcgtacgtcagtgag
gaagagactattcagagtgttacgtcacgtacggacttgtggctttatcgaaccgacaat
gtgctggattttcctcgtccaagcatgccaaacatggttcaggttggagggctgaatgtc
cgtgtggtcgccccccttactgagatcaagcgcagcaatatgggtattggaccaaagctt
cgaagttccacaattttactggttttccttggttttctgatcaggagcagcgcagagaag
gttctgatggtaccaccgccatgttaccacagccactggatgactctggccaaacttggt
cgtgccttggtggataaaggtcataccgtcactgtggttgcttcagaggacattgtagaa
aagcgtcgggcagagtggcctgactttcagtttgaggcattccaagaccaaggaacccaa
gcaaggatcatggaactacaagacaaggcttattcattggtggagatattgtctgtcttt
gaaatgagagaagaaatcgttgctgagtttggagagttgataaaacattgtgacttgctt
ctgggtgacggtaagctgcagaaccgactgaggacatcccagtacagcgttgtcattact
gatcccatctttgattgcggcgctatcctctcagcccatctagacgcccctcacgttgct
gttctgcgcggagatccctttttggacgaaacatcaacaggtgtaccgattcctccgtcg
tacgtaccatctctaggtaccgattttaccgatgatatgacctttggacaacgagtgcag
aacgttgccttgtcaactttcctatcagtggtaacacgccaggatctgagtagagcattt
gacggactggtccgtacgtacgtaggtgagaacgaaactattcagagcgtgacgtcacgt
acggacttgtggttgtatcgaaccgacaatgttctggattttcctcgtcccaggatgccc
aacatggttcaggttggaggactgaatgtccttgaggccgccccccttgctgaggacatg
gaagcgtttgtccagagctctggagacgatggaatgattgtcgtcagtttcgggtcgatg
ttcaagacgatgtcgacggaaaagcaagaagtcttcgcggcagccttcgcccgactccgg
cagaaggtggtgtggcggtacgtaggagagaaaccgaccgggctgggtaacaacaccaaa
ctactggcctggctgcctcagaacgatctgttggctcacccgaagacccgagccttcatc
actcacgctgggtcgaacggcctgtacgaggccctgcaccacggcgtgcccatggtctgt
ctgccgctgttttcggatcagcccgccaacgccgcccgggtggtggccaggggactgggg
gtgaagttggactttagcacggtcacgtccgaccagttgtaccaggccgttcttcatgtt
gtcaccaacacaagctaccgtgagacggcagcccgtctgtcccgtctgcaccgtgaccag
ccccagtcacccatggagcgggccgtctggtggatagaacacgtcatcaaacatggccga
ctgccccatctccgcgcacgcgccgtggagctgccgtggtaccagtactacctgctggac
gtgtccgcgttcctgctggccgtctgtgcagctgtcctgggtaccgtgtggtacagctgt
tcgttcttctgtaggaagatttgttgtaaaagtgtcggaaagttgaagtctcagtag

DBGET integrated database retrieval system