KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_63938Help
Entry
BRAFLDRAFT_63938  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BRAFLDRAFT_63938
   00053 Ascorbate and aldarate metabolism
    BRAFLDRAFT_63938
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_63938
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    BRAFLDRAFT_63938
   00860 Porphyrin and chlorophyll metabolism
    BRAFLDRAFT_63938
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    BRAFLDRAFT_63938
   00982 Drug metabolism - cytochrome P450
    BRAFLDRAFT_63938
   00983 Drug metabolism - other enzymes
    BRAFLDRAFT_63938
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     BRAFLDRAFT_63938
Glycosyltransferases [BR:bfo01003]
 Others
  Hydrophobic molecule
   BRAFLDRAFT_63938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 524 aa AA seqDB search
MMFFTPFISVTVTSLFLLSCQFAIGKKVLLVPVPFADSHWLAQANLGRALVNRGHTVTAL
VSEDSLAERQSAEFLFETFEDRGTRARLKALEGRLVSNAAEMSLVGVVQAAIMLSQEMMK
HCDFLLGDSNLLQRLRESRYGAVVTDPFFPCGAILAAHLQIPHVAHLRTNAYRIDLAATG
VPQPPAYVPDFLLPFTDQMTFLQRTQNAVVSAMMSLLSHWILSSNFDGLARKFLGEDETL
LSAMSRADLWLYQTDNVLDFPAPSMPNMIQVGGLNVREVVPLAADLETFVQSSGEDGVVV
VSFGSIVKTMPTERAEVWAAALARLRQKVVWRYTGEKPAGLGSNTKLMGWLPQNDLLGHP
KTRAFVTHAGYNGVSEALHHGVPMVCVPFFGDQPSNAARVVARGLGVKVEFSTVTADELY
KAILHVLTNNSYQETAARLSRLHRDQPQSPMERAVWWIEHVIKHGGLPHLRARAVELPWY
QYHLLDVAAFLLAVCAAVLGTVWYSCAFVCRMCCRKSYDKVKGQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttttcactccgtttatttcagtgactgtaacgtcgctgtttctcctatcctgt
cagtttgctattggaaagaaagtccttttagtacccgtaccatttgcagacagccactgg
ctagcccaagccaacctaggacgtgccttggtgaatagaggccatactgttaccgctctg
gtgtcagaagatagtttggcggagcgacagtctgcagagtttctgttcgagaccttcgag
gaccggggcacacgcgcaaggctgaaggcgctggaaggacgcctggtctccaatgctgca
gagatgtctctcgtgggggtggtacaagcggcgatcatgctgtcgcaggagatgatgaaa
cactgtgatttcctgttgggggacagcaacttgctacagcggctgagagaatcacgctac
ggtgctgtggtcaccgacccattcttcccgtgcggagccatcctcgccgcacatctccag
atccctcacgtcgcccacctccggacaaacgcctaccgcatcgacctcgcggccacggga
gtcccccaacctccggcctacgtgccggacttcctgctacctttcaccgaccaaatgacg
tttctacaaaggacgcagaatgcggtcgtctccgcaatgatgtctctgttgtcccattgg
atcctaagcagcaacttcgacggcttagctcgtaagtttctaggcgaggacgagaccctt
ctaagcgccatgtcgcgcgccgacttgtggctgtatcagacagacaacgtcttggatttt
cccgcgccctccatgcccaacatgatccaggtcggcgggttgaacgttcgtgaggtcgtt
ccccttgctgcagacctggaaacgtttgtccagagctctggagaggacggcgtggtggtg
gtcagctttggatcgatagtaaagacgatgcccacggagagagcagaggtgtgggcagca
gccctggcgaggctccgacagaaggtggtgtggcggtacacgggagagaagccagcaggg
ctgggaagtaacaccaagttgatgggctggcttcctcagaacgatctgctgggccacccc
aagacccgagccttcgtcacccacgcgggctacaacggcgtgagcgaagccctgcaccac
ggcgtgccgatggtttgcgtgccgtttttcggggaccagccttctaacgccgcccgggtg
gtggccaggggactgggggtgaaggtggagttcagcacggtcaccgcggacgagttgtac
aaggccattctacatgttcttaccaacaacagctaccaagagacggcagcccgcctgtcc
cgtctgcaccgtgaccagccccagtcacccatggagcgggccgtctggtggatagaacac
gtcatcaaacatggcggactgccccatctccgcgcacgcgccgtggagctgccgtggtac
cagtaccacctgctggacgtggccgcgttcctgctagccgtgtgtgcagctgtcctgggt
accgtgtggtacagctgtgcgttcgtctgtaggatgtgttgccgcaaaagttatgacaaa
gtcaaagggcaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system