KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_63938Help
Entry
BRAFLDRAFT_63938  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00040  Pentose and glucuronate interconversions
bfo00053  Ascorbate and aldarate metabolism
bfo00830  Retinol metabolism
bfo00860  Porphyrin and chlorophyll metabolism
bfo00980  Metabolism of xenobiotics by cytochrome P450
bfo00982  Drug metabolism - cytochrome P450
bfo00983  Drug metabolism - other enzymes
bfo01100  Metabolic pathways
Module
bfo_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BRAFLDRAFT_63938
   00053 Ascorbate and aldarate metabolism
    BRAFLDRAFT_63938
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    BRAFLDRAFT_63938
   00860 Porphyrin and chlorophyll metabolism
    BRAFLDRAFT_63938
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    BRAFLDRAFT_63938
   00982 Drug metabolism - cytochrome P450
    BRAFLDRAFT_63938
   00983 Drug metabolism - other enzymes
    BRAFLDRAFT_63938
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     BRAFLDRAFT_63938
Glycosyltransferases [BR:bfo01003]
 Others
  Hydrophobic molecule
   BRAFLDRAFT_63938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Peptidase_M17_N
Motif
Other DBs
NCBI-GeneID: 7209344
NCBI-ProteinID: XP_002611430
JGI: 63938
UniProt: C3XXI0
AA seq 524 aa AA seqDB search
MMFFTPFISVTVTSLFLLSCQFAIGKKVLLVPVPFADSHWLAQANLGRALVNRGHTVTAL
VSEDSLAERQSAEFLFETFEDRGTRARLKALEGRLVSNAAEMSLVGVVQAAIMLSQEMMK
HCDFLLGDSNLLQRLRESRYGAVVTDPFFPCGAILAAHLQIPHVAHLRTNAYRIDLAATG
VPQPPAYVPDFLLPFTDQMTFLQRTQNAVVSAMMSLLSHWILSSNFDGLARKFLGEDETL
LSAMSRADLWLYQTDNVLDFPAPSMPNMIQVGGLNVREVVPLAADLETFVQSSGEDGVVV
VSFGSIVKTMPTERAEVWAAALARLRQKVVWRYTGEKPAGLGSNTKLMGWLPQNDLLGHP
KTRAFVTHAGYNGVSEALHHGVPMVCVPFFGDQPSNAARVVARGLGVKVEFSTVTADELY
KAILHVLTNNSYQETAARLSRLHRDQPQSPMERAVWWIEHVIKHGGLPHLRARAVELPWY
QYHLLDVAAFLLAVCAAVLGTVWYSCAFVCRMCCRKSYDKVKGQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttttcactccgtttatttcagtgactgtaacgtcgctgtttctcctatcctgt
cagtttgctattggaaagaaagtccttttagtacccgtaccatttgcagacagccactgg
ctagcccaagccaacctaggacgtgccttggtgaatagaggccatactgttaccgctctg
gtgtcagaagatagtttggcggagcgacagtctgcagagtttctgttcgagaccttcgag
gaccggggcacacgcgcaaggctgaaggcgctggaaggacgcctggtctccaatgctgca
gagatgtctctcgtgggggtggtacaagcggcgatcatgctgtcgcaggagatgatgaaa
cactgtgatttcctgttgggggacagcaacttgctacagcggctgagagaatcacgctac
ggtgctgtggtcaccgacccattcttcccgtgcggagccatcctcgccgcacatctccag
atccctcacgtcgcccacctccggacaaacgcctaccgcatcgacctcgcggccacggga
gtcccccaacctccggcctacgtgccggacttcctgctacctttcaccgaccaaatgacg
tttctacaaaggacgcagaatgcggtcgtctccgcaatgatgtctctgttgtcccattgg
atcctaagcagcaacttcgacggcttagctcgtaagtttctaggcgaggacgagaccctt
ctaagcgccatgtcgcgcgccgacttgtggctgtatcagacagacaacgtcttggatttt
cccgcgccctccatgcccaacatgatccaggtcggcgggttgaacgttcgtgaggtcgtt
ccccttgctgcagacctggaaacgtttgtccagagctctggagaggacggcgtggtggtg
gtcagctttggatcgatagtaaagacgatgcccacggagagagcagaggtgtgggcagca
gccctggcgaggctccgacagaaggtggtgtggcggtacacgggagagaagccagcaggg
ctgggaagtaacaccaagttgatgggctggcttcctcagaacgatctgctgggccacccc
aagacccgagccttcgtcacccacgcgggctacaacggcgtgagcgaagccctgcaccac
ggcgtgccgatggtttgcgtgccgtttttcggggaccagccttctaacgccgcccgggtg
gtggccaggggactgggggtgaaggtggagttcagcacggtcaccgcggacgagttgtac
aaggccattctacatgttcttaccaacaacagctaccaagagacggcagcccgcctgtcc
cgtctgcaccgtgaccagccccagtcacccatggagcgggccgtctggtggatagaacac
gtcatcaaacatggcggactgccccatctccgcgcacgcgccgtggagctgccgtggtac
cagtaccacctgctggacgtggccgcgttcctgctagccgtgtgtgcagctgtcctgggt
accgtgtggtacagctgtgcgttcgtctgtaggatgtgttgccgcaaaagttatgacaaa
gtcaaagggcaatag

DBGET integrated database retrieval system