KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_66129Help
Entry
BRAFLDRAFT_66129  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     BRAFLDRAFT_66129
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   BRAFLDRAFT_66129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 375 aa AA seqDB search
MPTRFVLKIPCPISGCSGQSKLSQWVCARDNGTMYVDEDGYLSCYSNNHRAKIIYWRFDC
GERGSGSKHNYERYQAADLEGFSHAMAIGLPHLKEAGAVWVTKLIQNVEKQFFVLVLKST
SRICSIKLASFAMSGPMVYVTTKSYDVGTNRWGERPTILSMDDRPFAEGGMRRAYSAKDW
GILKSSCQPKVLKLQKHKRYTKAEAEADVKMQMKCVALAEKYNSHSCIPKKVSFCSAQLV
QFQAGPYKGQYGVLEDYIPGTFEKHNLNFPMRPVSCRNTPQAFSHFTFERTDGRMLVCDV
QGVGDQYTDPQIHCMDTDLQYGQGNFGAHGIISFVSNHRCNAICRALKLTPIRELPNRWG
SPPGKAATAPVPRYY
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcctacccgcttcgttctgaagattccctgtcctatctcgggatgctccgggcagtcc
aagctctcccaatgggtgtgcgcgcgagacaacggcaccatgtatgtagacgaggacggc
tacctgtcctgttactccaacaaccaccgcgccaaaatcatctactggaggttcgattgt
ggcgagaggggctcagggagcaagcacaactacgagagataccaagcggcggatctggaa
gggttctcccatgccatggctatcggcctgcctcacctgaaggaagctggagcagtctgg
gtcaccaaactcatacaaaacgtcgagaaacagttttttgtattggttcttaaaagtact
agtcgcatctgttctataaaacttgcatccttcgccatgtcggggccgatggtttatgtc
acgaccaaatcatacgacgtcggtaccaaccgctggggcgagcggcccaccatcctgtcc
atggacgaccggccgttcgcagagggcggcatgaggagagcctacagcgcgaaggactgg
ggcatcctcaagtcgtcctgtcagcccaaggtgctgaaactacagaaacacaaacgctac
accaaggcagaggcggaggcagacgtcaagatgcagatgaagtgtgtggcccttgctgag
aaatacaacagccacagttgcattcccaagaaggtgtcgttctgcagcgcccagctggtg
cagttccaggcgggcccgtacaaggggcagtacggcgtgctggaggactacatcccgggc
actttcgagaagcacaacctcaacttcccgatgagacctgtctcctgccgcaacactcca
caggccttctcacacttcacgtttgagcggacagacggcaggatgctggtgtgtgacgtg
cagggtgtgggagatcagtacacggacccacagatccactgcatggacaccgacctgcag
tacggccaggggaactttggcgcgcacggaatcatctctttcgtcagcaaccacaggtgt
aacgccatctgccgggcactcaagctcactcccatcagggagctgcccaaccgctggggc
tctccgccgggcaaggcggctacggctccggtgccgcggtattactga

DBGET integrated database retrieval system