KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_66174Help
Entry
BRAFLDRAFT_66174  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo01040  Biosynthesis of unsaturated fatty acids
bfo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BRAFLDRAFT_66174
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BRAFLDRAFT_66174
Lipid biosynthesis proteins [BR:bfo01004]
 Desaturase
  First
   BRAFLDRAFT_66174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase FUSC
Motif
Other DBs
NCBI-GeneID: 7214465
NCBI-ProteinID: XP_002596094
JGI: 66174
UniProt: C3Z5J3
AA seq 329 aa AA seqDB search
MATRYIDGAAGPLAGAVVSDLDEVPLPSPDVRNNKRPLEIVWRNAVLMALIHLGAIYGLF
LLPSARAYSLLWVVFCSVVVTCGLTAGAHRLWSHRSYKARLPLRVFLAIANSMSFQGSVY
EWCRDHRVHHKYCDTDADPYNAARGFFFAHVGWVFLRKHPDVKAKGKLLDMSDLMEDPVV
RMQKKFYIPSAVLMCFVIPTLVPLLWDESMSNAYFICALLRLAVALHCTWSVNSFAHMWG
TRPYDKHITPTENLVVSIFAGGEGWHNYHHAFPVDYSSSEFGWKVNPTTVFIDVMAWLGL
AYDLKKASPGVVRARAARTGDRSFKEHVQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaaggtacatcgacggcgctgcaggcccgttggcgggggcggtcgtatctgat
ctcgacgaagttcccctgccgtcacccgatgtccggaacaacaaacgaccgttggagata
gtctggcgtaacgctgtgctgatggctcttatacacctgggggctatttatgggctgttc
ttgctgccttcagcacgggcctactctctactttgggtggtattttgtagtgtggtagtc
acctgtggtttgactgcgggcgcacacaggctatggagtcaccggtcctacaaggccaga
ctgccgctaagggtcttcctcgctatcgccaacagcatgagcttccaggggagcgtttat
gagtggtgtcgtgaccatcgtgttcatcacaagtactgcgacactgacgccgatccctac
aacgcagcacgtgggttcttcttcgcgcacgttggctgggtcttcttacggaagcaccca
gatgtaaaggccaaggggaagcttctcgacatgagtgacctaatggaagatcctgttgtc
cggatgcagaagaagttctacataccctcagccgtgctgatgtgcttcgtcatccccacg
ctggtaccgcttctctgggacgagagtatgagcaacgcctatttcatttgcgctctcttg
cgattagcagttgcgctacactgtacttggtccgtgaacagtttcgctcacatgtggggt
acaaggccatatgacaagcacatcaccccaactgaaaacctcgtggtctccatcttcgcc
ggaggtgaggggtggcataactaccaccacgcatttcccgtcgactactcctctagcgag
tttggatggaaagtcaaccccacaacggtcttcatcgacgtcatggcctggctcggcctg
gcctacgacctgaagaaggcctcaccaggtgtcgttcgtgcaagagctgccaggaccgga
gacaggtcttttaaggaacacgtacagtaa

DBGET integrated database retrieval system