KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_68992Help
Entry
BRAFLDRAFT_68992  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03173  
TNF receptor-associated factor 2
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    BRAFLDRAFT_68992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 631 aa AA seqDB search
MKRQGTWTAICASVLTGRRDDITETKRDWLNNPGKRAAYFEASNMPGYQLEIFEVRVEEK
YLCSACRLVLREPFQTYCGHRYCKSCLDEIFRLPGIQMCKQCPQDTQSEDSLLKRDQAFP
DRAIKRDIGELPVKCGNADACEWKGKAHQYDEHQENCEFGLILCPKQGCGKQVMRMDLAA
HLEKECAVRQVKCKYCAQEILLKDEKDHLFICPQVPVNCDFCGKKKIPRAQLQQHQDENI
GDCRRLKVACPFAIVGCPAKLEREKLNDHIAKHQADHLSLVLDKYHTLISLIQGQVHQYD
GGANCGVVDFPTTVSGQVMGPLQQGASSQPSALMKTPGGRLQGGQQQDVHIKSLTDMFNV
VVAAVSKLRGGAEPDSELVKMLENRMEQIASMMEEIEHKHEAMEARVATFEDIVAVLNRE
IEKCSATIEAYERQRRQDREIIESIERKMKSQERIIALKDVALAEQDLRITSLEMTSYDA
TLLWKIQDFTRKRHDAITGKTTSIYSPCFYTSRTGYKMCARIYLNGDGMGKGSHISLFFV
LMRGHFDGLLRWPFRQRVTFMLLDQNNREHVIDAFRPDPTSSSFKRPTSDMNIASGCPLF
MPLSQLESTRHAYVRDDEIFLKIIVDTSDLN
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgccaaggaacctggacagccatttgtgccagtgtgcttacagggagacgcgat
gatatcaccgaaaccaaacgtgattggttgaacaatccaggtaaaagggcggcttatttt
gaggcctccaacatgcctggctatcaactggagatatttgaagtcagggttgaagaaaag
tatctgtgctcagcatgccgcctggtgttgcgggaacccttccagacatactgtgggcac
agatactgcaagtcatgcctggatgagatcttcaggctgccaggtatccagatgtgtaag
cagtgcccacaggatacacagtcagaggactctctgctcaagcgtgatcaggcttttcca
gacagagctatcaaacgggacattggtgaactccctgtcaagtgtgggaatgcagacgcc
tgtgaatggaaggggaaagcacaccagtatgatgaacatcaggagaactgtgagtttggc
ctgattttatgtccgaagcagggatgtggcaaacaggtgatgagaatggatcttgctgca
catctggagaaggagtgtgccgtcagacaagtcaagtgcaagtactgtgcacaggaaata
ctgctgaaggatgaaaaggaccatcttttcatctgccctcaagtccccgtgaactgtgac
ttctgtgggaagaagaagataccaagggctcagttgcagcaacatcaggatgaaaacatt
ggagattgcagaaggctgaaagtagcctgcccatttgctatcgtcggatgtcctgcaaag
ctggaacgtgagaaactgaatgaccacatcgccaagcaccaggcggatcacctgagcctt
gtgctggacaagtatcacaccctcatcagtctcatacaaggccaagtacatcagtatgat
ggtggtgccaactgcggcgtggtggactttcctacgactgtcagtggtcaagtcatgggg
ccacttcaacagggagcttcatcacagccatcagcgctgatgaagacaccaggcggtagg
ctgcagggtgggcaacagcaagatgtgcacattaaaagtttgactgatatgtttaacgtc
gtggtagccgcagtatcgaagctgaggggtggggcagagcctgattcagagcttgtaaag
atgcttgagaacagaatggagcagattgctagtatgatggaagaaattgagcataagcat
gaagccatggaggctagggtcgccacttttgaggatatagttgctgtcctcaatcgtgag
attgagaagtgttcggccaccatcgaggcatacgagcgacagcgacgccaggaccgagag
atcatcgagtccattgagcgtaagatgaagtctcaagagcgaatcatcgccctcaaagac
gtggcccttgccgagcaggatctccgtatcacatccctggagatgacatcctacgatgcc
accttgctgtggaagatccaagacttcacaagaaaacgtcacgacgccatcactggtaag
acaacctccatctactccccctgcttctacaccagccgtacaggatacaagatgtgcgcc
cggatctacctgaacggtgatggcatggggaaggggagccacatctctctgttcttcgtc
ctgatgagggggcactttgacgggctgctgcgctggccattccgccagagggtgaccttc
atgttgcttgaccagaacaaccgtgagcacgtgatcgacgcgttccggcccgacccaaca
tcttcttccttcaaacgccccacaagtgatatgaacatcgccagtggatgtccgctgttc
atgccactcagtcagttggagagtacacgccatgcctacgtacgcgatgatgagattttc
ttaaaaatcatcgtggacacgtctgacctaaattaa

DBGET integrated database retrieval system