KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_68997Help
Entry
BRAFLDRAFT_68997  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03173  
TNF receptor-associated factor 2
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:bfo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 482 aa AA seqDB search
MPGYSREIFEVRVEDKYLCSACRLVLREPFQTYCGHRYCKSCLDEIFEYAFPDRAIKRDI
GDLPVKCLNAGLCEWKGKAEQYDEHQETCEFVLIPCPKQGCGKQVMRMDLAAHLEKECAV
RQVKCKYCAQEILLKDEKDHLFICPQVPVNCDFCGKKKIPRAQLQQHQDEDTGDCKRLKV
ACRFAKVGCQAKLEREKLNDHIAKNHVDHLNHLLDNHLTLMEKVNLLKQNPQAQHMQQAM
ASKQEEMRHKYVAMETRVATFEGIVAVLNREIEKCSATIEAYERQRRQDREIIESIERKM
KSQERIIALKDVALAEQDLRITSLEMTSYDATLLWKIQDFTRKRHDAITGKTTSIYSPCF
YTSRTGYKMCARIYLNGDGMGKGSHISLFFVLMRGHFDGLLRWPFRQKVTFMLLDQNNRE
HVIDAFRPDPTSSSFKRPTSDMNIASGCPLFMPLSQLESTRHAYVRDDAIFLKIIVDTSD
LN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccaggatactcacgggaaatctttgaagtcagggtagaagacaagtacctgtgctca
gcatgccgccttgttctccgggaacccttccagacatactgtggtcatcgctattgcaaa
tcatgtctggatgaaatcttcgagtacgcatttccggatagagctatcaagcgagacatt
ggagacctgccagttaagtgtctgaacgcaggtctgtgtgagtggaaagggaaggcggag
caatatgatgaacaccaagagacatgtgagtttgtcctaatcccatgtccaaagcaagga
tgtggcaaacaggtgatgagaatggatcttgctgcacatctggagaaggagtgtgctgtc
agacaagtcaagtgcaagtactgtgcacaggaaatactgctgaaggatgaaaaggatcat
cttttcatatgccctcaagtccccgtgaactgtgacttctgtgggaagaagaagatacca
agggcccagttgcagcaacatcaggatgaagacaccggagattgtaaaaggctgaaagta
gcctgcagatttgctaaagtcggatgtcaggcaaagctggaacgtgagaaactgaatgac
cacatcgccaagaaccatgttgatcacctgaaccacctgctagacaatcatctgactctc
atggaaaaggtaaacctcctgaaacagaacccacaggctcaacacatgcagcaggcaatg
gctagtaagcaggaagaaatgaggcataagtatgtagcaatggaaactagggtcgctact
tttgagggtatagtcgcagttctcaatcgtgagattgagaagtgttctgctaccattgaa
gcatatgagaggcagcggcgccaggacagagaaatcatagagtccattgagcgaaagatg
aagtcccaggagagaatcatcgccctcaaagacgtggcccttgctgagcaggatctccga
atcacatccctggagatgacatcctacgatgccactctcctctggaagatccaagacttc
acaagaaagcgacatgacgccatcactggtaagacaacatccatctactccccctgcttc
tacaccagccgtacaggttataagatgtgtgcacgcatctacctgaacggtgatgggatg
gggaagggcagccacatcagcctgttcttcgtcctgatgagggggcactttgatgggtta
ctgcgctggccattccgtcagaaggtgaccttcatgctcctggaccagaacaaccgtgag
cacgtgatcgatgcgttccgccctgatccaaccagttcatctttcaagcgcccaaccagt
gacatgaatattgcaagtggctgtccactgtttatgcccctcagccagttggagagtaca
cgccatgcctacgtccgcgacgatgcgattttcttaaaaatcatcgtggacacgtcggat
ttaaactaa

DBGET integrated database retrieval system