KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_69200Help
Entry
BRAFLDRAFT_69200  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BRAFLDRAFT_69200
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BRAFLDRAFT_69200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 542 aa AA seqDB search
MDLAMKDYQRFMMWHMLEQFWVRKDTESGCCTVRWQMPLWACQKRMFPYVPQQKKRWRQK
KVVPARLVPVQRDRIPSIGQTRLVHLDLKGAPPKISYLAQVIPLFKKFGATGLLVEYEDM
FPYNGELRELAGAHAYSQEEIQQLQELAKEHDMLYVPLVQTFGHFEFVLKHDKFRHLREV
DMYPMALCPSNAESLVVVKKMIDQVMAAHPDVKYLHIGADEVFHLALHRTMWSDRQLFLD
HIMTVLSYIKVMYPNVKAIMWDDMLRETSMAHLQVVIHHVSASVPLIAYGIGEMVEPMVW
CYLPRLSGTFLTGATGSSQYIVPINYHLQNHLAWLAQLDNIPSSLTVQGWALTGWSRYDH
YATHCELLPAAIPSLALCLQTVVHGGFTEDCAFHRKVSEELGFSQTIQVQVVPKIKTIAQ
EGRFPGAKLFQAVHVLVNLDADYIEFLNGDRYTGWMTDYHVRKNFTNPCHLEFIIHVASR
LQEEFSKLHREMDSCLSEVYDPSTVEEWLVVHFKSPIDKLSEILGTAKTQIERYSSKNTC
SS
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggacttggccatgaaggactaccaaaggtttatgatgtggcacatgctagagcagttc
tgggtaagaaaggatacggaatccgggtgctgcacggtgcggtggcagatgccgctgtgg
gcctgccagaaacggatgtttccttacgtacctcagcagaagaagcgatggagacagaag
aaggtggttccagccaggctggtgccagtgcagagagacagaatcccaagcataggtcag
accagacttgttcatctagacctgaaaggggcacctcccaaaatcagctacctggcccag
gtcatccccctgtttaagaagtttggtgcaacaggactgctggttgagtatgaggacatg
tttccctacaatggtgagctgagagaactggcaggtgcacatgcctacagccaggaagag
atccagcagcttcaggagttagcaaaggaacatgacatgctgtatgtgccgctggtgcaa
acctttggtcactttgagtttgtgctgaagcatgacaagtttcgacacctgagagaggtg
gacatgtatcccatggctctctgtcccagcaatgcagaatcattagtagtagtgaagaag
atgatcgatcaggtgatggcagcacaccctgatgttaaatacctgcacataggagctgat
gaggtgtttcacctggccctgcatagaactatgtggtcggaccgtcagctgttcctggac
cacatcatgacggtgctgagctacatcaaggtcatgtaccccaatgtcaaggccatcatg
tgggacgacatgttgagggaaaccagcatggctcatctgcaggtggtaatacaccatgtt
tctgcatctgtgcccctgatagcctacggtataggtgagatggtggagcccatggtgtgg
tgttacctacccaggctgtctggaacattcctcactggtgctactggtagttcccagtac
attgtccccatcaactaccacctacagaaccacctggcctggctggcacagctggacaac
attccctccagccttactgtacagggctgggcactcactggctggagcagatatgaccac
tatgccacacactgtgagctgctaccagctgccatacctagcctggcactctgccttcag
acagtggtacacggtggcttcacagaagactgtgccttccacagaaaggtgtcggaggag
ctggggttttcccaaaccatccaggttcaagtggtgcccaaaattaagaccatagcacag
gaaggcagatttcctggtgcaaagctgttccaggctgtgcatgtactggtgaatctggat
gcagactacatagagttcctcaacggtgacaggtacacaggctggatgacggactaccat
gtcaggaagaacttcaccaacccctgtcatctggagttcatcattcatgtggcatccaga
cttcaagaagagttctccaagctccacagagaaatggacagctgcctgtcggaggtgtat
gacccgagtactgtggaggagtggctagtagtacacttcaagtctcccatagacaagctg
agtgaaatcctcggaactgcaaagacacaaattgaacgttattccagcaagaacacatgc
agcagctag

DBGET integrated database retrieval system