KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_70494Help
Entry
BRAFLDRAFT_70494  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_70494
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BRAFLDRAFT_70494
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     BRAFLDRAFT_70494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1932 aa AA seqDB search
MEVGERREHRCSWLRRIGKTLQYGLLCLFVSLRSALVSVRNCCAFVFFGDTPEGLCKCSS
NTKDSSFYEDFNRPPEIKVMAEGGPTTNSVAAGHTVATSPSGAAAQNSPVRQVQQVRVLQ
LNDGEHLNTTLFRLQKGWTLHFFLGPSLCARPVRIFVNHPPADRPFRRDEYYELKWQYYS
QSRCDDSDRYAELQLKLAGSFQYFFSYDNSGNKKHGSGYFVVDPLLPLPGGDVLPLDSIC
IQTVLSKCIGPFSNWERCVRVSKETGYNMVHFTPIQALGESNSSYCISDQMRINPAFEED
GRTLTYDDVGEFVRRIHKDWGVLTVTDLVLNHTSWDSPWLVEHPECGYNLLNSPHLRPAY
LLDRALAYFSGQVADGQWEGQGVPANITNDGHIRAMERILLEQVLPELKLWEFYCADVED
LVQQFKEACEEVGNALPEAGGKKYQLTVVQDPAYRRLMSSVDLGRALTIFNVERTDAETE
KERIQKCSEAFRKHLEKLNADVTRDLQHHLKAAVENCGKGVGYERLDGQGPKLGPVTRQK
PLVTEYFRLLNGQNDSWQADEKLMNKKDARHILAHNGWVMGDDPLRNFAEAGSNVYLRRE
LLAWGDNVKLRYGKRPEDCPFLWKHMLEYTMATARIFHGVRIDNCHSTPIHVAEFMLDAA
RQVNPDLYVVAELFTGKEDLDNVFVNRLGITSLVREAMSAFDSHEEGRLVYRYGGEPVGA
FWKPATRPLTPAIAHAMFLDLTHDNPCAIQKRSVYDPLPSAALVAMASCAIGSTRGYDEL
VPHHIHVVEEARCYPVWDDDSKKDDVQSVNNRSGIIAAKRALNLLHQQLGMAGFNQVYVD
QVDENIVAVTRHCPNSHHSVILVARTAFKHPHNPQATGYIPPLCIPGVVEEIILEARLVQ
KSPDEFNQDGTFINGLNNYQLEMQEHIQFMLDAARQVNPDLYVVAELFTGKEDLDNVFVN
RLGITSLVREAMSAFDSHEEGRLVYRYGGEPVGAFWKPATRPLTPAIAHAMFLDLTHDNP
CAIQKRSVYDPLPSAALVAMASCAIGSTRGYDELVPHHIHVVEEARCYPVWDDDSKKDEV
RSVNNRSGIIAAKRALNLLHQQLGMAGFNQVYVDQVDENIVAVTRHCPNSHHSVILVART
AFKHPHNPQATGYIPPLCIPGVVEEIILEARLVQKSPDEFNQDGTFINGLNNYQLEMQEH
IQLYGSAMIELSGGGEGSNSPVQEVDFINFPPGSIIAFRVSLPQHTRQAVSTLRGCLREF
GFHVRPGSPKGEQRWDFLSIVSELSLSDLNRVLYRCDPEERDEGWGGGVYHIPGWQSLKY
CGLQGFISVMADIRNTNDLGHPFCENLRQGDWMPDYIANRLVRHRTTKKLGQWFEGVFDS
LKEIPRYLIPCYFDAILAGAYATITEITWGQMSEFVTQGSTLVRALALCSAQFCGDVASS
PLPHLSTKILKDIPTVVNEETGRREQRCSTLAAGLPHFSSGVMRCWGRDTFIALRGLLLV
TGRYSDARNLILAFAGCLRHGLIPNLLGAGAHARFNCRDAVWWWLQCVQDYCTMVDDGLD
ILTLPVCRLFPTDESPPRDSGYTEEPLYKIIQEALQRHAQGISFRERHAGPSLDINMSSE
GFNVNAGVDWETGFVFGGNEHNCGTWMDKMGESDMAGNKGKPATPRDGSAVEIVALCKST
LRWLVALHQSGAYPYDGVTFLTDGKETTVTFAEWDAKLQDNFEKKFWVASEPYEGEEKPG
LIHRRGVYKDSVGASFPWTDYQLRPNFCIAMAVAPELFTPERAWKALEIVETVLLGPLGV
KTLDPKDWKYRGNYINSVDSHEVETARGFNYHQGPEWLWPVGYFLRAKLHFSSLVGGADT
FYKCIDKVKVTLSNHHQALLKSPWKGLPELTNADGAFCKDGCPTQAWSASTILDVLYDMD
KLVRGNNQMSTV
NT seq 5799 nt NT seq  +upstreamnt  +downstreamnt
atggaggttggagagcgccgggaacacaggtgctcgtggctgaggaggatcgggaagacg
ctgcagtacggtctgctgtgcttgttcgtgtcgctccgatcggcgctcgtctctgtcagg
aactgttgtgcgtttgtgttctttggggacacaccggagggtctgtgtaaatgttcttcc
aacactaaggactcgtcattctacgaggacttcaaccgcccgcctgagatcaaagtcatg
gcagagggaggaccgacgaccaactctgtggccgcgggacacaccgtagcgacatcgccc
tcgggcgccgcggcgcagaactcgcctgtacgacaggtgcagcaggtgcgggtgctgcag
ctgaacgatggggagcacctgaacaccactctgttccgcctgcagaaaggctggaccctt
cacttcttcctgggtccctcgctgtgtgcccggcctgtccgcatctttgtcaaccacccg
cccgctgaccgccccttccgtcgggacgagtactatgagttgaagtggcagtattactcc
cagagccgctgcgatgattcggacagatacgctgagctgcagctgaaactcgctgggtcc
ttccagtactttttctcctatgacaacagtggaaacaagaagcatggttccgggtacttc
gtggtggatcccctcctccccctcccaggcggagacgttctgccgctggatagcatctgc
atccagaccgtcctctccaagtgcatcggccccttcagcaactgggagaggtgcgtccgc
gtctccaaggaaaccggctacaacatggtgcacttcacgccgatacaggcgctgggcgag
tccaactcttcgtactgcatcagcgaccagatgcggatcaaccccgcgttcgaggaagat
ggacgtacgctgacgtacgatgacgttggagagtttgtacgccgtattcacaaggactgg
ggcgtgctgacggtcacggacctggtgctgaaccacaccagctgggacagcccgtggctg
gtggaacacccggagtgcgggtacaacctgctgaactcaccccacctgcggccggcgtac
ctgttggacagggcgctggcgtacttcagcggacaggtggcagacgggcagtgggagggg
cagggcgtgcccgccaacatcaccaacgatggccacatcagggctatggagcggatccta
ttggaacaagtcctgcctgagctgaagctgtgggagttttactgtgcagatgtggaggat
ctggtgcagcagtttaaagaggcttgtgaagaagttgggaatgctctaccggaggcagga
gggaagaagtaccagctgactgtggttcaggacccagcctaccgacgactcatgagctct
gtggacctgggcagggcactgactatcttcaacgtggaaaggacagatgcagagacagag
aaggaaaggatacagaagtgcagcgaggccttcaggaaacacctggagaagctgaacgca
gacgttacgagggacctgcagcatcacctgaaggcagctgtagagaactgtgggaagggt
gtcggctatgagagactggatggccagggaccgaaactggggcctgttacaaggcagaag
ccactggttacagagtatttcagacttctaaatggccagaacgactcctggcaggctgac
gaaaagttaatgaacaagaaggacgcccggcacatcctggctcacaacggctgggtgatg
ggggacgaccccctgcgaaactttgcggaggccggctcaaacgtctacctgcggcgcgag
ctcctcgcctggggcgacaacgtgaagctcaggtacgggaagcgtccggaggactgcccg
tttctatggaaacacatgctggagtacaccatggcaacggcacggatcttccacggtgtt
cgcatcgataactgtcacagcactcccatacatgtggcggagtttatgctggacgcagcg
cgacaggtgaaccctgacctctacgttgtggcggagctgttcaccgggaaagaggacctc
gacaacgtgtttgtgaaccgactcggaatcacatcgcttgtacgagaggccatgagtgca
tttgactcgcatgaagagggccgtttggtgtaccggtacggcggcgagccagtcggcgcc
ttctggaaacctgccacacgacctctgacccctgcgatcgcccatgccatgtttcttgac
ttgactcatgacaatccatgcgcaatacagaaacgttctgtgtacgacccgttaccgagt
gctgctctggttgccatggcgagctgtgctatagggagtacccgtggttacgatgaactc
gtacctcaccatattcatgttgttgaggaggcgcgatgttacccagtgtgggatgatgac
tccaagaaggacgacgtccaatccgttaacaatcgctccggtatcatcgcagcgaaacgg
gcactcaacctgctgcatcagcaattaggcatggcaggcttcaaccaggtttatgttgat
caagtggatgagaatattgttgcagtgaccaggcactgccccaactcccaccattcggtc
atcctcgtggccaggacagccttcaaacacccacacaaccctcaagcaactggctacatc
cccccactctgtatacctggtgttgttgaggaaatcatcctggaggccaggttggttcag
aagtcgcctgacgagtttaaccaggacggaaccttcatcaacggactcaacaactaccag
ctggagatgcaggaacacatccagtttatgctggacgcagcgcgacaggtgaaccctgac
ctctacgttgtggcggagctgttcaccgggaaagaggacctcgacaacgtgtttgtgaac
cgactcggaatcacatcgcttgtacgagaggccatgagtgcatttgactcgcatgaagag
ggccggttggtgtaccggtacggcggcgagccagtcggcgccttctggaaacctgccaca
cgacctctgacccctgcgatcgcccatgccatgtttcttgacttgactcatgacaatcca
tgtgcaatacagaaacgttctgtgtacgacccgttaccgagtgctgctctggttgctatg
gcgagctgtgctatagggagtacccgtggttacgatgaactcgtacctcaccatatccat
gttgttgaggaggcgcgatgttacccagtgtgggatgatgactccaagaaggacgaagtc
cgatccgttaacaatcgctccggtatcatcgcagcgaaacgggcactcaacctgctgcat
cagcaattaggcatggcaggcttcaaccaggtttatgttgatcaagtggatgagaacatc
gttgcagtgaccaggcactgccctaactcccaccattcggtcatcctcgtggccaggaca
gccttcaaacacccacacaaccctcaagcaactggctacatccccccactctgtatacct
ggtgttgttgaggaaatcatcctggaggccaggttggttcagaagtcgcctgacgagttt
aaccaggacggaaccttcatcaacggactcaacaactaccagctggagatgcaggaacac
atccagctatacggcagtgctatgatagagctatcaggaggaggggaggggagtaactca
cctgtgcaggaggtcgacttcatcaacttcccaccgggcagtatcatcgcatttcgggtg
tcccttccccagcacacacgccaggccgtctccaccctcaggggctgtctgagagagttt
gggttccacgtcaggccggggagtccaaagggggagcagagatgggacttcctaagtatt
gttagtgagctgtccctgtcggacctgaaccgcgtactataccggtgtgaccctgaggag
agagatgaggggtggggaggaggcgtgtaccacatcccagggtggcaaagcctcaagtac
tgcggactacaaggtttcatatctgtgatggcagacatcagaaacaccaatgacttaggc
catcccttctgtgaaaacctgcgccagggagactggatgccagactacatcgctaacagg
ctagtcaggcacaggacaaccaagaagcttggccagtggtttgagggagtgtttgactcc
ctgaaggagatccccaggtacctgatcccgtgctactttgacgcgatcctggcgggagcg
tacgccaccatcacggagataacctggggacagatgtccgagtttgtgacccagggctca
acactggtccgtgctctggccctgtgctcagcccagttctgtggagatgtcgcatcttcc
cccctccctcacctctccactaagatcctgaaggacatcccaacggtggtcaatgaagaa
acaggtcgtagagaacaaagatgtagcaccttagcagctggattgccccacttttcctcg
ggggtgatgaggtgttgggggagggacacattcatcgcactcaggggactgctgttggtg
acaggcagatacagcgatgcaaggaaccttattcttgcctttgccgggtgcctgagacat
ggcctgatccccaacctgctgggcgccggtgcacacgcccggttcaactgccgggacgca
gtgtggtggtggctgcagtgtgtccaggactactgcaccatggtcgacgatggccttgac
atcctcactctcccagtgtgccgtctgttcccaacggatgaaagtcctccaagggattct
gggtacacggaagaaccactctacaagataatccaggaggcactacagcgccatgcccag
gggatctcgttccgcgagcgccacgccggaccgagcctagacatcaacatgtcatcagaa
gggtttaatgtgaatgcaggggtggactgggagacagggtttgtgttcgggggcaacgag
cacaactgtgggacctggatggacaagatgggagagtcagacatggcgggaaacaaggga
aaacctgctacacccagggatggatcagcagtagaaattgtggctctctgcaagtccaca
ttaagatggttggtggccttgcaccagagcggtgcctacccttacgacggcgtcacgttc
ctgacagacgggaaggaaaccacggttacctttgccgagtgggacgcgaagctgcaggac
aattttgagaagaagttctgggtagcgtcagagccgtacgagggggaggagaaaccaggc
ctcatccacaggagaggcgtctacaaggacagtgttggggcatccttcccgtggactgac
taccagctccggcctaacttctgtatagccatggcggtggcgccagagctgtttacacct
gagagagcctggaaagcactggagattgtagaaactgtcttgcttggaccgcttggagta
aaaactctggacccaaaagactggaaatatcggggaaactacatcaactctgtggacagt
catgaggtggagactgccaggggattcaactatcaccaggggccggagtggctttggcct
gttggttacttcctgagagccaagctgcacttctcctccctggtgggtggggccgacacc
ttctacaagtgcatcgacaaggtcaaggtcacgctgtccaaccaccaccaggccttgctc
aagtcgccttggaaggggctgcctgagctgaccaatgcagacggtgccttctgcaaagat
ggctgcccaacgcaggcctggtcagcgagcacaatacttgacgtcctttacgatatggac
aagctagtcagagggaataatcaaatgagcacagtttaa

DBGET integrated database retrieval system