KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_72229Help
Entry
BRAFLDRAFT_72229  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03847  
alpha-1,6-mannosyltransferase [EC:2.4.1.260]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    BRAFLDRAFT_72229
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.260  dolichyl-P-Man:Man7GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase
     BRAFLDRAFT_72229
Glycosyltransferases [BR:bfo01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   BRAFLDRAFT_72229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 483 aa AA seqDB search
MIADVLLGVVAFFHLVACPYTKVEESFNVQATHDILFHRQNLEKYDHHEFPGVVPRTFVG
PLFISGLAAPFVALTQLIWENKFIAQYLVRGCLGLCVLYGFSAFRRAVSKKFGSDVGTML
VLLTATQFHFMFYITRPLPNVFALSVVLFALSSWLAGKHGSFIWQSGFAIIVFRSELCLF
LGLILLHELGTRRLGVLELLRHGVPAGVVCLAVTVSVDSVFWQKLLWPEGAVLHYNTILN
KSSNWGTEPFLWYFYSAIPRALSASTLLVPAGMWLDSRIAKTVAPALGFVLLYSILPHKE
LRFIIYVFPVLNVAAARFCTTVYHSWHKSKRWVVAALIVVGHLMANCAATAVFMYVSHHN
YPGGYALHTLHQTVPSHTEVHVHIDVGSAQTGVSRFGQLNSNWRYDKTEDLTPGGAQMMA
YTHLLLEATNQPQLYTKSHDTLVTVEGFSGIQKQFRSFPPIAIKTEPRIIVLAKKKGESR
GTA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcagacgttttgttaggcgtggtggcgttcttccacctcgtagcctgtccctat
acgaaagtggaagagagttttaacgtacaggcaactcacgacatcctatttcaccggcaa
aacctggaaaagtatgatcaccatgagtttcccggagtggttccacgcaccttcgtcggt
ccactgtttatctcaggcctggcggctccattcgtggccctgacacagctgatatgggag
aacaagttcatcgcacagtacttagtgcgtgggtgcctgggcctgtgtgtgctgtacggt
ttctctgccttccgtcgtgccgtcagcaagaagtttggttcagatgtggggacaatgctg
gtcctgctgacagccacgcagttccacttcatgttctacatcaccagacctctgcccaat
gtgttcgcactgtcggtggttctttttgctctgagttcctggttagcggggaagcacggt
tctttcatctggcagtcgggattcgcgattatcgttttccggtctgagttgtgcctgttc
ctggggctgatcttactgcatgagctgggcaccaggagacttggtgtgttagaactactg
agacatggtgttccagctggcgtggtgtgtctggctgtgactgtgtcggtagactctgtg
ttctggcagaagctgctgtggcctgagggagcagtgctgcactataacaccatcctcaac
aagagctccaactggggtactgaaccatttctgtggtacttctactccgccatcccccgt
gccctgtcagccagcacactcctggtgcctgcagggatgtggttagactccaggatagcc
aagactgtggctccagctctgggcttcgttctgctgtactccatcctgccacacaaggag
ctcaggttcatcatctatgtcttccctgtgctgaacgtggcagcggcaaggttctgtaca
acagtttaccacagctggcacaagtcaaagcggtgggtcgtggcagccttgattgtggtt
ggtcacctgatggcgaactgtgcagcgacagctgtattcatgtacgtgtcgcaccacaac
taccccggagggtacgcactgcacacattgcaccagactgtaccaagtcacacagaggtc
catgtccacattgatgtaggctctgcacagactggagtctctaggtttggtcaactcaac
tccaactggaggtacgataaaacagaagacctcacgccgggaggcgcccaaatgatggct
tacacacacctgctactggaggcaaccaaccaaccacagctgtacaccaagtcacatgac
accctcgtcaccgtggagggtttcagtgggatacagaagcagtttcgcagttttcctccg
atagccatcaagacagaaccccggattattgttctcgcgaagaaaaagggggaaagccgc
ggcactgcatga

DBGET integrated database retrieval system