KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_73566Help
Entry
BRAFLDRAFT_73566  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BRAFLDRAFT_73566
Messenger RNA biogenesis [BR:bfo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     BRAFLDRAFT_73566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 340 aa AA seqDB search
MKDIEVASPPDDSVAALAFSPAATATTFLVSGSWDNNVRCWQIEQNGQTIPKAEQKHTGP
VLDVCWSDDGTKVFSASCDKQAKCWDLNSNQCIQVAQHDAPIKTVHWVKAPNYTCLMTGS
WDKTLKFWDTRSPNPMMTIQLPERCYCADVMYPMAVVGTAGRGIIVYQLDNQPKEYKKIE
SPLKYQHRCVSIFKDKDARPTGFALGSIEGRVAIHYVNATNPRDNFTFKCHRSNGSNNAV
QDIYAVNGIAFHPVHGTLATAGSDGKFSFWDKDARTKLKTSEQLAQPISACTIDPRGNIF
AYAASYDWSKGHEYYNPQQQKPCILLRSCAEELKPRNRRT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacatcgaggtcgcctcgccgcctgacgacagcgtggcagcgctggccttcagc
cccgcggccaccgctaccaccttcctggtgtcagggtcctgggacaacaacgtgcgctgc
tggcagatcgagcagaacggacagaccatccccaaggcggaacagaagcacacgggcccc
gtgctggacgtgtgctggtctgatgacggcaccaaggtgttctcagctagctgcgataaa
caagccaagtgctgggacctcaacagtaaccagtgcatccaggtggctcagcatgacgcc
cccatcaagaccgtacactgggtcaaggcccccaactacacctgcctgatgaccggcagc
tgggacaagaccctgaagttctgggacacgcgcagccccaaccccatgatgaccatccag
ctgcctgagaggtgctactgtgccgacgtcatgtaccctatggctgtggtgggcaccgca
ggccggggcatcatcgtctatcagctggacaaccaaccaaaggagtacaagaaaatagag
tcacccctgaagtaccagcatcgctgtgtttccatcttcaaggacaaagacgcacgccct
acggggtttgctctgggatccattgaagggagggtggccatccactacgtgaacgccacc
aacccacgagataacttcaccttcaagtgtcaccgatcgaacggcagtaacaacgccgtg
caggacatctatgctgtgaacggaatagcgttccatcccgtccacgggactctggcgacc
gccgggtctgatggcaagttcagcttctgggacaaggacgctcgtaccaagctgaagacg
tcggagcagctggcccagcccatctccgcgtgcaccatcgacccgcgcggaaacatcttc
gcgtacgcggcgagttacgattggtccaagggccacgagtactacaacccgcaacagcag
aaaccttgcatccttctgcgtagctgtgctgaagaactcaagccacgaaacagacgaacc
taa

DBGET integrated database retrieval system