KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_80158Help
Entry
BRAFLDRAFT_80158  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BRAFLDRAFT_80158
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRAFLDRAFT_80158
   00640 Propanoate metabolism
    BRAFLDRAFT_80158
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BRAFLDRAFT_80158
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    BRAFLDRAFT_80158
Enzymes [BR:bfo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BRAFLDRAFT_80158
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BRAFLDRAFT_80158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 924 aa AA seqDB search
MNTWVNRQMSLPAAISFRRVLDCTEFPDITIFRNWPVTKRRSGQGSGGRRSSRKDHHHKD
FMVATPDEFVSRFGGNKVISEVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVAMVTP
EDLKANAEYIKMADQYVPVPGGANNNNYANVDLILDIAKRIPVQAVWAGWGHASENPKLP
ELLHNNNISFIGPGESAMWALGDKIASTIIAQSANVPTMAWSGSGLKIEWSEEAMKAGKS
IEVPQQLFKQACVETAEDGIKSAAAIGYPVMIKASEGGGGKGIRKVETEEDFPAAFRQVQ
NEVPGSPIFIMKLAKSARHLEVQLLADQYGNAISIFGRDCSIQRRHQKIIEEAPTTVAPP
DIWDRMEKVRIGSVSMVTVSMVTVSMTTVAPPDIWDRMEKLLSPWLLFPFTTVTTPDIWD
RMEKVRIVSGSMVTVSMTTVAPPNIWDRMEKVAMGVPLYRIKDIRLLYGEDPWGDTPIDF
DSPVHRPVPRGHVIAARVTSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVLGFKPSSGT
VQELNFRSSKNVWGYSSMSGFKPSSGTVQELNFRSSKNVWGYFSVSASGGLHEFADSQFG
HCFAWGEDRDDAVSNMVIALKELSIRGDFRTTVEYLIKLLETDTFQNNAISTGWLDRLIA
EKVQAERPDTMLGVICGAMHVADHQIKSAVDHYRMSLERGQVLPPTTLTNTVELELIFEG
FKYCLEVTRQSPSSYFLMMNDSTIEVDHALNVPPRLSDGGLLLSFDGNSYTTYMKEEVDR
YRVVIGNKTIVFEKENDPSVLRSPSAGKLIHYLVEDGGHVFSGQAYAEIEVMKMVMALTV
TESGCVHFVKRAGAILSPGSVVANLALDDPSRVQQAQVFTTGFPTHHNVDLKGEKINLIF
QDARQKLENVMRGYCLPNPYFKQK
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgaatacctgggtaaacagacagatgagtctcccggcagctatctccttccgacgtgtc
ctggactgtaccgaatttcccgacatcaccatatttagaaactggcctgttactaaacga
aggtcaggtcaggggtcgggaggtcggaggtcgtcgcggaaggaccaccaccacaaggac
ttcatggtggccacgcccgacgagttcgtgtctcgctttgggggcaacaaggtcatcagc
gaggtgttgatagcgaacaacggcatcgctgcagtgaagtgcatgcggtccatccgccgc
tgggcctacgagatgttccgcaacgaacgcgccatccggtttgttgccatggtgacgcca
gaagatctgaaggccaacgcagagtacatcaagatggcggaccagtacgtgccagttccg
ggcggcgccaacaacaacaactacgccaacgtggacctcatcctggacatcgccaagcgg
attcctgtgcaggcggtgtgggctggctggggccatgcctcggagaacccgaagctgcca
gaactcctgcacaacaacaacatctcgttcatcgggccgggcgagtccgccatgtgggcg
ctgggagacaagatcgcttccaccatcatcgcacagagcgccaacgtgcccaccatggcc
tggagcggcagtgggttgaagattgagtggagcgaggaggccatgaaggccggcaagtcc
atcgaggttccgcagcagctcttcaaacaggcatgtgtcgaaactgcagaggacggcatc
aagagtgccgcagccatcgggtaccctgtgatgatcaaggcgtcggaggggggcggtggg
aagggcatccggaaggtcgagacggaggaggatttccccgcggcgttccgacaggttcag
aacgaggtgcccggctcgcccatcttcatcatgaaacttgctaaaagtgcccgtcacctg
gaagtgcagctattggctgaccagtacgggaacgccatctccatatttgggcgtgactgt
tctatccagcgccgacaccagaaaattatcgaggaggcaccgactactgtggcccctcct
gacatctgggacaggatggagaaggtaaggatcggctctgtttccatggttactgtatcc
atggttactgtttccatgactactgtggccccgcctgacatctgggacaggatggagaag
ttactgtctccatggttactgtttccatttactactgtgaccacgcctgatatttgggac
aggatggagaaggtaaggattgtctctggttccatggttactgtttccatgactactgtg
gccccgcccaacatctgggacaggatggagaaggtagccatgggcgttcccctgtaccgg
attaaggacatccggctgctctatggggaggacccttggggggacacacccatagacttt
gacagcccagtacacaggccggtaccgagaggtcatgtcatcgccgccagggtcaccagc
gaaaacccagatgagggatttaagcccagctccgggaccgtgcaggagctgaatttccgc
agcagtaagaacgtctgggggtacttcagtgtgttaggatttaagcccagctccgggact
gtacaggagctgaatttccgcagcagtaagaacgtgtggggctactccagcatgtcagga
tttaagcccagctccgggaccgtacaggagctgaatttccgcagcagtaagaacgtgtgg
gggtacttcagcgtgtcggccagcggaggtctgcacgagttcgctgactcgcagttcgga
cactgcttcgcctggggggaggatagggacgatgctgtatcaaacatggtgatagccctg
aaggagctgtccatccggggagatttccgcacgactgttgagtacctcatcaagctgttg
gagaccgacaccttccagaacaatgccatcagcactggctggctggacagactcatcgcc
gagaaagtacaggcggagcgtccagataccatgttaggagtgatctgtggagcgatgcac
gtggctgaccaccagattaagagcgcggtggatcactaccggatgtcgctagagcggggg
caggtcctcccgccgaccacactcaccaacactgtggagctggaactcatcttcgagggg
ttcaagtactgtctggaggtgacccgccagtcccccagctcctacttccttatgatgaac
gactccaccatcgaagtcgaccatgctttaaatgttccccccaggttgagtgatggtggt
ctcctcctgtcattcgacggcaacagctacacgacctacatgaaggaggaggtggatcgc
taccgcgtcgtcatcggcaacaagaccatcgtgtttgagaaggaaaacgacccgtccgtg
ctgaggtctccttcagcggggaagctgatccactacctggtggaggacggaggtcacgtg
ttcagcgggcaggcttatgccgagatcgaggtcatgaagatggtcatggcgctcaccgtc
accgagagtggatgcgtccattttgtgaagcgagctggagccatcctgagcccaggcagc
gtggtagccaacctggccttagatgaccccagtagagttcagcaggcacaggtcttcact
acaggcttccccacacatcacaacgtggatctcaaaggggagaaaatcaacctgattttc
caggatgcgagacagaagctggagaatgtgatgagagggtactgcctgcctaacccatac
ttcaaacagaag

DBGET integrated database retrieval system