KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_81516Help
Entry
BRAFLDRAFT_81516  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRAFLDRAFT_81516
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BRAFLDRAFT_81516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1231 aa AA seqDB search
MTYMVFGHFEKPMFLELCRHMETMSINEGDMLFKVGQPDDSIFVVVQGKLTVYITEKDGT
EMQMKEVLAGDSVHSLLSILDVITGYPAPYKTVSCRALEKSTILRLPANALQTVFKKYPE
SLVRVVQIIMVRLQRVTFMALHNYLGLTTQLMNKVIMLRLQRVSFMALYNYLGLSSELVR
KIDTCSRGCSRTQSLHHHHHHHHHHPSHTMGPPKSPKKLASTTSVGSSTEKVIRSVNFED
APRARISRLASVRGMSVDSEGSGAESGPSDFDTACDRARVGQGVVGTPPVARRHSGEHRR
RLDYFVEHHRLRHTSHDDSFLHRAAFFDTQESTDSAVLSKYQQWTEDDEVLDAATEDLAK
LFGLDEETLLRGRLTLEHYRAGQYLVHQGDQDSSLFFVATGTLLVCQKTVDTEEEETVLI
VSHSGELVGVLAALTGEPSFFSVKAKHDSRVVAITKSNFYSIMRDCPHVVLNVAHAFVSR
MSPFVRQIDFALDWMLIDAGRALYRQGDPSDSTYVVLNGRLRSVHTLANGRKQLMGEYGR
GEIVGVVETLTQSPRASTVHAIRDTELAKMPAGLLDTIKRKHPQVVTRLIHLLGQRILGH
MQQRPQAPLLDIPDAPSVACHMANANLTTVALLPASEDVPLTTFSLDMYHSLTAIGSTLR
LTSDIIKTRLGIAAFDSVQEFRLSSWLGQQEDIHRIVLYQADPRMTAWTQRCIRQADCIL
IVALGDKEPTVSELENQMDAMAVRAQKELVLLHKEDVVSPIGTADWLNARSWISSHHHIS
CPKRIFTRKNPKKVMEMYEKMFEKDPDRHSDFARLARFLTGTSVALVLGGGGARGAAHIG
VMRILQEQGIPVDIIGGTSIGALMGALWAEERNWRAVADRARSFFSDLWIPYFNITTDVS
ASKMRIHTDGDVWRYVRASMTFHPYLPPMCDTRDGHLLVDGCYVNNLPGSLWRYVRASMS
LSGYLPPLCDPKDGHLLLDGGYVNNLPADVAKSMGANFVIAVDVGSQDDRNLTHYGDYLS
GWWVLYKKWNPFTEKIRVLDMSEIQQRLAYVSCMKQMEEVKCCDYVEYVRPPIDRYKTLQ
FGSFDEIMEVGYAHAVPIFTDWRRADEVFGVRPPVEEQARHPLTGIQSNAYFTDLAELVS
RIPQQISQREATISDDEYSSEYEDEEDADSGLVVSTSVPNLAEASDEPKKREAISEGGTP
TDENNLGTLETELRQRHSHAELRESAEEEET
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atgacctacatggtatttggtcactttgagaagcccatgttcctggagctgtgccgccac
atggagactatgagtattaatgagggggacatgctcttcaaagtcggacagcccgatgac
agcatctttgtggtggtacaaggcaagctgactgtttatattacagaaaaggatggcaca
gaaatgcagatgaaggaggtgcttgcaggagacagtgtgcacagtctgctgagcattctg
gatgtcatcacaggctaccctgcaccatacaaaactgtgtcatgtagagcactggaaaag
agcaccattctcaggctccctgctaatgcattacaaaccgttttcaagaagtacccagaa
tctctggtcagagtggtgcagatcatcatggtgcgtttgcagcgggtaactttcatggct
cttcacaactacctgggtctcaccacacaactcatgaacaaggtgataatgctccgtctg
cagcgagtgtctttcatggccctgtacaactacctaggcttgagctctgagcttgtccgt
aagatagacacatgtagtaggggatgcagccgcacacagtccctccaccaccaccaccat
catcaccaccaccacccctcccacacaatgggaccgcccaagtctcctaagaagttagcc
agtaccacctctgtagggagttctacagaaaaggtcatcagatctgtcaacttcgaggat
gctccacgtgctaggatttcccgccttgccagtgtcaggggcatgtcagtggacagtgag
gggagtggggcagagtcgggtccctcggatttcgacaccgcctgtgacagggccagggtt
gggcagggcgttgtcggcaccccaccagtggccaggagacatagtggggagcaccgacgt
agacttgactattttgtagaacaccatcggctccgacacaccagtcatgatgacagcttc
ctccacagggctgcgttctttgacacccaggagagcaccgactcggcagtcctctccaag
taccaacagtggacggaggacgatgaagtcttggatgcagcaacagaagacttggccaaa
ttgtttggcttggatgaggagacccttttgcgaggcaggctgaccctggaacattaccgg
gcggggcagtacctggtgcatcagggtgaccaggactccagtctgttcttcgtcgccacg
ggaacgctcctggtctgtcagaagactgtggacactgaggaggaggagacagtgttgata
gtgtcccactcaggtgagctggtgggagtgttagcagcactgacaggggagccgtccttc
ttcagtgtcaaggccaaacatgacagtagggtggtggccatcaccaagtccaacttctac
agcataatgcgagactgtccccacgtagtgctgaacgtggcccatgcctttgtgagcagg
atgtcaccgtttgtacgacagattgacttcgctctggactggatgctgattgatgcaggc
agggctctgtacagacaaggggacccatcagactccacatatgtcgtgttgaacggacgt
ctccggtcggtgcacaccctcgctaacggcaggaaacagctgatgggagagtacggcaga
ggggaaatagttggagtggttgagaccctgacccagtctcctcgagcgtccaccgtccac
gctatccgagacacggagctggccaaaatgccagctgggctgctggacactatcaagaga
aaacaccctcaggttgtgactcgccttatccacctgcttggccagcggatcctgggccac
atgcagcagagaccacaggcgcctcttctcgacattccagatgcccccagtgtggcctgt
cacatggccaatgccaacctgaccactgtggccttgctgcctgcctccgaggacgtgcca
ctgaccaccttctccttggacatgtaccactcccttacggccataggctcgacactgaga
ctaaccagtgatattatcaagacaagattaggaattgctgcatttgacagtgtccaggag
ttccgactgtccagctggcttggtcagcaggaggacatccacaggattgtgctgtaccag
gctgaccccaggatgaccgcctggacacagcgctgcatccgacaggctgattgcatcctt
atcgtggcgctaggggacaaggaaccgactgtcagtgagctggagaaccagatggatgcg
atggcggtgcgtgctcagaaggaactggtgctgctgcacaaggaggacgtggtgtctccc
atcggcacggctgattggctgaacgctcgcagctggatctcctcccaccaccacatcagc
tgtcccaagaggatattcacacgcaagaaccccaagaaagtgatggagatgtatgagaag
atgtttgagaaggatcctgatcgacactccgacttcgctcgcctggcacgtttcctcacc
ggtacatctgtggccttggtgctgggcggagggggagcaagaggtgcagcccacatagga
gtgatgcgaattctacaggagcagggcatccctgtagacatcatcggaggtaccagtata
ggggccttgatgggcgcactgtgggcagaggagaggaactggcgtgctgtcgcagatagg
gccagaagcttcttctctgacctgtggatcccttactttaacatcactacagacgtctca
gcctccaagatgagaatccacacggatggtgacgtgtggcggtatgtgcgagccagcatg
acctttcacccctaccttcctcccatgtgtgatactcgcgatggccacttgcttgttgac
ggctgctacgtgaataatttgccaggttccttgtggcgctatgttcgggccagcatgtcc
ctatcggggtacctccccccactttgcgatcccaaagatggccatttgttactggatggg
ggttacgtcaacaacctaccagccgatgtcgctaagtccatgggtgccaacttcgtcata
gcggtggacgtgggttcacaggatgatcggaacctgacacattacggagactacctgtct
ggctggtgggtcctgtacaagaagtggaaccccttcacggaaaagattagggtgctggac
atgagtgagatccagcagcgcctggcctacgtgtcctgtatgaagcagatggaggaagtc
aagtgttgtgactatgtggagtatgtcagaccacccatcgacaggtacaagactttacag
tttggttcctttgatgagatcatggaggtggggtatgcccatgccgtgcccatctttact
gactggcggcgagcagacgaggtgttcggggtgcggccacctgtggaggagcaggccagg
catccactgactgggatccagtccaatgcctacttcactgacctggctgagctggtgtcc
aggattccccagcagatctcacagagggaagccaccatatcagacgatgagtattcctca
gagtatgaggatgaggaggatgcagacagtggtctggtggtctccacgtccgtaccaaac
ctggcagaggcttcggatgaaccaaagaagagagaggccatctctgagggcggtacccct
acagatgagaacaacctggggacgctggagacggaactccgacagagacacagccatgct
gagctgagggagagtgcagaggaggaggagacttga

DBGET integrated database retrieval system