KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_82305Help
Entry
BRAFLDRAFT_82305  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00010  Glycolysis / Gluconeogenesis
bfo00071  Fatty acid degradation
bfo00350  Tyrosine metabolism
bfo00830  Retinol metabolism
bfo00980  Metabolism of xenobiotics by cytochrome P450
bfo00982  Drug metabolism - cytochrome P450
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_82305
  Lipid metabolism
   00071 Fatty acid degradation
    BRAFLDRAFT_82305
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRAFLDRAFT_82305
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    BRAFLDRAFT_82305
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    BRAFLDRAFT_82305
   00982 Drug metabolism - cytochrome P450
    BRAFLDRAFT_82305
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRAFLDRAFT_82305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 adh_short
Motif
Other DBs
NCBI-GeneID: 7232724
NCBI-ProteinID: XP_002597589
JGI: 82305
UniProt: C3Z1I3
AA seq 360 aa AA seqDB search
MARRSMRLVEYGKPFQLMQEEVPSAPKGGAVVKNEYAGVCHTDAHSADDEFSGLAPLKCV
LGHEMAGTIVDIDPSAELKVGDKVIVYWHGGCGECSRCEVGETTACLKDIKHWAGITEDG
GFSDYVVIPDAKLLVKVPDTVAMDAACLLPCSGITAYNAVCNMVPTVQDFAKHSADCAVL
LVGAGGLGLWGVQFAKQLLPAGVRVLSADVDEEKLATAKAAGCDEALLWGKDVDDDTAVA
AAKKACGSLGAAVAAIDFVNVPATFGRIEKILVQGGMHVVVGLLGGDAPAAVPLMPYVLS
RHHMAGVLMGSLPQLKDLVALMAKGNVKPPPISHHPLENVYDVLQDLKAGKVKGRAVVKL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcgcagcatgaggttggtggagtacgggaagcccttccagctgatgcaggag
gaggtaccctctgcaccaaagggcggggctgtcgtcaagaatgagtacgcaggagtgtgc
catactgatgcccacagcgcagatgatgagtttagcggactcgcccctctgaagtgcgtc
ctcgggcatgagatggcaggcaccatcgtcgatatcgaccctagtgccgaactcaaggtc
ggagacaaggtgatcgtgtactggcacggcgggtgtggggagtgcagcaggtgtgaggtg
ggggagacgactgcctgcctcaaggacatcaaacactgggccgggatcactgaggatggc
ggtttctcggattacgtcgtcattcccgacgcgaagttgctggtgaaggtgcctgacacg
gttgccatggacgcggcgtgcctcctgccctgctcggggataaccgcctacaacgccgtc
tgcaacatggtgccgacagtacaggacttcgctaaacactctgcggactgtgcagtactg
ctggtgggcgctggggggctcgggctgtggggtgtccagtttgccaagcagcttcttcct
gccggagttcgcgttctcagcgccgatgtggacgaggagaaactggctactgcgaaagcg
gccgggtgtgatgaagctcttctgtggggcaaggatgttgatgacgacaccgctgtggct
gcagcaaagaaagcctgtggcagcctcggcgccgctgtggcagctattgacttcgtcaac
gtgcccgctacctttgggcgtattgagaagatacttgtccagggaggcatgcacgtagtg
gtgggactgctaggcggagacgcccccgctgccgtgccgctgatgccgtacgtgctgagt
cgccatcacatggccggggtgctcatgggatcgctgccgcagctcaaggatctggtggcg
cttatggccaaggggaacgtgaagccgccgcccatttcccatcatcccctggaaaacgtc
tatgacgttctgcaggatctgaaggctggaaaggtcaaaggtcgcgctgttgttaagctt
tga

DBGET integrated database retrieval system