KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_82305Help
Entry
BRAFLDRAFT_82305  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BRAFLDRAFT_82305
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_82305
  Lipid metabolism
   00071 Fatty acid degradation
    BRAFLDRAFT_82305
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRAFLDRAFT_82305
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    BRAFLDRAFT_82305
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    BRAFLDRAFT_82305
   00982 Drug metabolism - cytochrome P450
    BRAFLDRAFT_82305
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRAFLDRAFT_82305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 360 aa AA seqDB search
MARRSMRLVEYGKPFQLMQEEVPSAPKGGAVVKNEYAGVCHTDAHSADDEFSGLAPLKCV
LGHEMAGTIVDIDPSAELKVGDKVIVYWHGGCGECSRCEVGETTACLKDIKHWAGITEDG
GFSDYVVIPDAKLLVKVPDTVAMDAACLLPCSGITAYNAVCNMVPTVQDFAKHSADCAVL
LVGAGGLGLWGVQFAKQLLPAGVRVLSADVDEEKLATAKAAGCDEALLWGKDVDDDTAVA
AAKKACGSLGAAVAAIDFVNVPATFGRIEKILVQGGMHVVVGLLGGDAPAAVPLMPYVLS
RHHMAGVLMGSLPQLKDLVALMAKGNVKPPPISHHPLENVYDVLQDLKAGKVKGRAVVKL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcgcagcatgaggttggtggagtacgggaagcccttccagctgatgcaggag
gaggtaccctctgcaccaaagggcggggctgtcgtcaagaatgagtacgcaggagtgtgc
catactgatgcccacagcgcagatgatgagtttagcggactcgcccctctgaagtgcgtc
ctcgggcatgagatggcaggcaccatcgtcgatatcgaccctagtgccgaactcaaggtc
ggagacaaggtgatcgtgtactggcacggcgggtgtggggagtgcagcaggtgtgaggtg
ggggagacgactgcctgcctcaaggacatcaaacactgggccgggatcactgaggatggc
ggtttctcggattacgtcgtcattcccgacgcgaagttgctggtgaaggtgcctgacacg
gttgccatggacgcggcgtgcctcctgccctgctcggggataaccgcctacaacgccgtc
tgcaacatggtgccgacagtacaggacttcgctaaacactctgcggactgtgcagtactg
ctggtgggcgctggggggctcgggctgtggggtgtccagtttgccaagcagcttcttcct
gccggagttcgcgttctcagcgccgatgtggacgaggagaaactggctactgcgaaagcg
gccgggtgtgatgaagctcttctgtggggcaaggatgttgatgacgacaccgctgtggct
gcagcaaagaaagcctgtggcagcctcggcgccgctgtggcagctattgacttcgtcaac
gtgcccgctacctttgggcgtattgagaagatacttgtccagggaggcatgcacgtagtg
gtgggactgctaggcggagacgcccccgctgccgtgccgctgatgccgtacgtgctgagt
cgccatcacatggccggggtgctcatgggatcgctgccgcagctcaaggatctggtggcg
cttatggccaaggggaacgtgaagccgccgcccatttcccatcatcccctggaaaacgtc
tatgacgttctgcaggatctgaaggctggaaaggtcaaaggtcgcgctgttgttaagctt
tga

DBGET integrated database retrieval system