KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_82306Help
Entry
BRAFLDRAFT_82306  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bfo01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfo00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bfo00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bfo00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:bfo00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:bfo00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:bfo00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 358 aa AA seqDB search
MARRSMRLVEYGKPFQLMKEEVPTAPKGGAVVKTEYAGVCHSDVILMDGDFPIPLNTVLG
HEIAGTVHDIEPGQDLKVGDRVAAFFRGGCGDCSRCEMGEPIACLQGVRRGLGSTVDGGY
SDYVIIPDARLLVKVPDTVTMDTACLLPCSGLTAYNAVCTIVPTVQDFVKHNGDCAVLLV
GAGGLGLWGVQFAKQLLPAGVRVVCADVEDEKLTTAREAGCDGTLLWRKDVDNNNAVAEA
KKVCGSLGGFAAAIDFVNVPATFERVEKILAQGGMHVLVGLMGVGVSASVPLMPYVLGRH
QMTSLVVGSLPQLTDVMLLVAQGKIKPPPISHHTLENVYDVLKDLKAGKVKGRAVVKL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcgcagcatgaggttggtggagtacgggaagcccttccagctaatgaaggag
gaggtacccactgcacccaagggcggggctgtcgtcaagacggagtacgccggagtgtgt
cattctgatgtcatcctcatggacggagacttccccatacctctcaatactgttcttggg
catgagatagctggcacagttcacgacattgagcctgggcaggatctaaaggtaggggac
agagtggctgcgttttttcgtggtggttgcggagattgtagcaggtgcgagatgggggag
ccaatcgcatgtcttcagggcgtcaggcgaggccttggatcaacagtagatggcgggtac
tcggattacgtcatcatccctgacgccagactgttggtgaaggtgcctgacacggttacc
atggatacggcgtgcctcctgccctgctcggggctgaccgcctacaacgctgtctgtacc
atagtgcccaccgttcaggacttcgtcaagcataatggagactgtgcggtactgttggtg
ggcgctggggggctcggcttgtggggtgttcagtttgccaagcagcttcttcctgcagga
gttcgcgttgtctgcgctgatgtggaagacgaaaagctgaccacagccagagaggctgga
tgtgatgggactctgctgtggagaaaggatgttgataacaacaacgctgtggccgaggcc
aagaaagtttgcggcagcctcggtggttttgcggcggccatagacttcgtcaacgtgcca
gctacctttgagcgtgttgagaagatattagcacagggagggatgcatgttttggtgggt
ttgatgggagtcggtgtttcggcttccgtgccgctgatgccgtacgtgctaggtcggcat
cagatgacctctttggtcgtcggatcgctgccacaactgactgatgtcatgctcctcgtg
gcacagggaaagatcaaaccaccgcccatttcccatcataccttggagaacgtctatgac
gtcctgaaggatctgaaagctggaaaggtcaaaggtcgcgcggttgtaaagctgtga

DBGET integrated database retrieval system