KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_82309Help
Entry
BRAFLDRAFT_82309  CDS       T01074                                 

Definition
hypothetical protein
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 356 aa AA seqDB search
MARRSMRLVEYGKPFQLMKEEVPAAPKGGAVVKTEYAGVCHSDLHSLEGDFRTLVPMQTV
LGHEIAGTVHDISPEAGFKVGDRVAVYWHGGCGACSRCEVGETTACLKDVKHWAGINEDG
GFSDYVIIPDVRLLVKVPDTVTMDTACLLPCSGLTAYNAVCKMVPTVQDFAKHNADCAVL
LVGAGGLGLWGVQFAKQLLPAGVRVISADVDNEKLAAAKEAGCDDVLLWSKDVDDDTAVA
AAKKVCGGLGAFAAAIDFVNVPSTFERVEKILAPGGMHVLVGLLGVGAAGSVPLMMYVLG
RHQMGAVLMGSLPQMKELMALMAQGKKKMDTNFVENQITNNTLLEPFVLNKNVYST
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcgcagcatgaggttggtggagtacgggaagcccttccagctgatgaaggaa
gaggtacccgctgcacctaagggtggagctgtcgtcaagacggagtatgccggcgtgtgc
cactccgacctgcacagtctggagggagacttccgcacgctggtgcccatgcagactgtt
ctggggcacgagatagctggcacagtgcacgatattagccctgaagcaggctttaaggta
ggagacagggtggccgtgtactggcacggcgggtgtggggcctgcagcaggtgtgaggtg
ggggagaccactgcctgtctcaaggacgtcaagcactgggctgggataaacgaagatggc
gggttctccgattacgtcatcattcctgacgtcagactgttggtgaaggtgcctgacacg
gttaccatggatacggcgtgcctcctgccctgctcggggctgactgcctacaacgccgtc
tgtaagatggtgccgacagttcaggacttcgccaagcataacgcggattgtgcagtactg
ctggtgggcgctggggggctagggctgtggggtgtccagtttgccaagcagcttcttcct
gcaggagttcgcgtcatcagcgctgatgtggacaacgagaagctggctgcagctaaagaa
gccggatgtgacgatgttcttctttggagcaaagatgttgatgacgacaccgctgtggct
gcagcaaagaaagtctgtgggggcctcggtgcttttgcggcagccatcgactttgtcaat
gtgcccagtacatttgagcgcgtagagaagattctagctccgggaggtatgcatgtcctg
gtgggtctgctgggagtcggtgccgccggttccgtgccgctgatgatgtacgtgctgggt
cggcaccagatgggcgcggtgctgatgggttccctgccgcagatgaaggagctcatggct
ctgatggctcaggggaagaaaaagatggacaccaactttgtggaaaatcagatcacgaac
aacacccttttagaaccatttgtcctgaacaaaaatgtttacagtacctga

DBGET integrated database retrieval system