KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_83447Help
Entry
BRAFLDRAFT_83447  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BRAFLDRAFT_83447
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    BRAFLDRAFT_83447
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     BRAFLDRAFT_83447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 667 aa AA seqDB search
MASCAKHCVAYLFLLGVLSVPAASVYTLTDQGGLGSRFDGVGGLSGGGATSRLLVSYPEP
YRSQVLDYLFKPNFGAALQILKVEIGGDAQSTDGSEPSHMHSADDQNYTRGYEWWLMREA
KKRNPGIKLYGLPWAFPGWVGGGEPYPDPELTAEYVINWILGAKRVHGLTIDYVGIWNEK
EYDVTYIKTLRKTLDDNDLGHVMIVAADGDWLRISEDVMADPELAKVVDTIGAHYPGTNS
IPMARQTGKPLWASEDYSTFNDPKGASCWARILNQNYVNGHMTSTIAWNLVASYYDNLPY
PRDGLMTANQPWSGHYEVSDPIWATAHTTHFTSPGWQYLNGVGHLDGGGSYVALADGKGN
LTIVIEAMSHQYSKCVRPLLPPYSVAPTQIVNFRLGGAFEKITHLYVWFSKFVGNSTARF
ERRDPPIKVTGGHFSVEVKENCLYTLTTIQKVRNTPTNYPDSPASAPFPLPYKDNFDGPA
NSSEARYFADQTGVFELFVNDSSPDHVGTMRQVVTERPIFWCKKGPTDSPISVVGDHNWT
DVTVSCDVLVERQGGAFVAARVDRGGCVIKDALGFFLWVFADDTWALSYDLALKNIVKAG
KLNATVVGQWHRLDLYSKGDTVKGSANGQVLFELKTGPLPIKKGFAAIGSLDFKHVQFDN
FVVDRTK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctgtgcgaaacattgcgtagcctacctgttccttctaggagttctatctgtt
cctgcggcgtcagtctacaccctaacggaccagggcgggttggggtcgaggtttgacggg
gttggaggcctgagcggtggaggagcgacctcgcgcctcctggtgagctaccccgagccg
taccggtcccaggtcctggactacctgttcaaacccaacttcggggcggcgctgcagatt
ctcaaagtggagataggaggagacgctcagagcacggacggcagcgagccgtcgcacatg
cacagcgcagacgaccagaactacacgcgcgggtacgagtggtggctcatgcgggaggcc
aagaagcgcaacccgggcatcaaactgtacgggctgccctgggccttcccggggtgggtg
gggggtggggagccctacccagacccagaactaacagcagaatacgtcatcaactggatc
cttggcgccaaaagggtccacggcctgaccatcgactacgtgggcatttggaacgagaag
gaatatgacgtcacctacatcaagactctaaggaaaacgttggacgacaatgatctgggt
cacgtgatgatcgtggccgcggacggcgattggctgaggatttctgaagacgtcatggcg
gatcctgagctggccaaggtggtggataccattggtgcgcactatccggggactaacagt
ataccaatggcgcgacaaactgggaaacccctatgggcttcagaagactacagtaccttc
aacgaccccaagggagcctcgtgttgggcacgcatcctcaaccagaactacgtcaacggt
cacatgaccagcaccatcgcctggaatctcgtcgccagctactacgataacctgccgtac
ccgcgagatggtctgatgacagccaaccagccctggagcggtcactacgaggtcagtgac
cccatatgggcgaccgctcacaccacccacttcacctctcccggctggcagtacctgaac
ggcgtcggtcatctggacggcggggggagctatgtggccttggctgacggaaagggaaat
ctgacgatcgtcatagaggctatgagtcaccagtattccaaatgcgtccgcccccttctc
ccgccatactctgtcgctccgacacagattgtcaatttcaggctaggtggcgcttttgag
aaaatcacacacctgtacgtttggttttcgaaattcgtcggcaactccaccgctcggttc
gagagaagagatccccccatcaaggtcacgggaggccatttctctgtagaggtcaaagag
aattgtttgtatactttaaccacaatacagaaggttcgaaatactcccacaaattaccca
gactcccctgcgtcggcgccgttcccacttccatataaggacaactttgacggaccagcg
aactccagtgaggcccggtacttcgcagaccagacaggggtgtttgaactctttgtgaac
gacagcagtccggatcacgtgggaacgatgaggcaagtcgtcacagagaggccgatcttc
tggtgcaagaaaggtcccacagattcaccaatcagcgtcgtcggggaccacaattggacc
gacgtcacagtcagttgcgatgtcctggtggaacggcaagggggcgcttttgtggcggcg
cgagtggaccgcgggggttgcgtcatcaaggacgccctcggcttcttcctctgggtgttt
gcagacgacacttgggcgctgtcgtacgacctcgcgctgaaaaacatcgtgaaagcaggg
aaactaaacgccacagtagtcggacaatggcatcggttggatctttattcaaaaggggac
accgtgaaagggtcggcaaatggacaagtgctgtttgaattgaaaaccggaccgcttccc
atcaagaaaggattcgccgccattgggagcctggatttcaaacatgtacagtttgataac
tttgtagtcgacaggacaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system