KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_83810Help
Entry
BRAFLDRAFT_83810  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BRAFLDRAFT_83810
   00053 Ascorbate and aldarate metabolism
    BRAFLDRAFT_83810
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_83810
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    BRAFLDRAFT_83810
   00860 Porphyrin and chlorophyll metabolism
    BRAFLDRAFT_83810
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    BRAFLDRAFT_83810
   00982 Drug metabolism - cytochrome P450
    BRAFLDRAFT_83810
   00983 Drug metabolism - other enzymes
    BRAFLDRAFT_83810
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     BRAFLDRAFT_83810
Glycosyltransferases [BR:bfo01003]
 Others
  Hydrophobic molecule
   BRAFLDRAFT_83810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 554 aa AA seqDB search
MFATVVPVLRYMIILTQKTSLLLLLVLSTSMSTGFHLFLAVVAILSQHVQAADILVATST
YNSPWMDVAKIAEALASRGHVVTVLAHASQKNDLMRKWPTLQYETFGDPEKPPSVKEFSK
TVPQKLAFSSSGMLGLLTFGSTLSSALLDLGEEMLSDNQLLTKLKNSHYDVVLTYAGPSC
GPLVAQYLDLPLVSTMRSFPTGQDIRATGVPNPLAYVPTVTSELSDRMTFLQRLKNVLVY
FAATTMGQLVVDKSYDDLAKRTIGDSFTMSAALARTDVWLYQSDLMFDFPKPMMPNMVSI
AGHMAEDVKPLSEELEKFVQSSGDDGVVLVTFGSLVAAMPADIADMLAAAFARLPQKVVW
RYAGTPPPSLGPNTKTMEWVPQIDLLAHPKTKAFVSHCGYNGVAEAMYHGVPLVGMPLFA
EQFDNIARMVARGMAVSLDIHTVTSEEVYRAITTVISDPSFKEKANQISTHLRDQPQSPM
ERAVWWIEHVIKHGGLPHLRSRAPELPFYQYYLLDVIALIVAVISAVLLSCWKCCSFACN
MCKKGTTITKKKVN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctacagtagtgcctgttttgaggtacatgatcattctgacacagaaaacttca
ctattactactgctggtgctgagtactagtatgtcgactggtttccacctgttcctggcg
gttgtcgccatcttgtctcaacatgtccaagctgccgacatcctcgtggcgacatcaacc
tacaacagcccctggatggacgtggcgaagattgccgaagccttggcctcccgagggcac
gtcgtcaccgtgctggcccatgctagtcagaagaacgacctgatgcggaaatggccgacc
ttgcagtacgaaacattcggagatcccgaaaaaccaccgtcggtgaaggaattctcaaaa
acggtgcctcagaagttggcgttttcttcatctgggatgttgggactcctaacgtttggc
agcactttgagttctgcactgctggaccttggtgaagagatgctgagtgacaatcaactg
ctgacgaaactgaagaacagccactatgacgttgtcctgacgtatgctggtccctcatgc
gggcccctggtggcgcagtacttggacctgcctctagtcagcacgatgaggtcttttcct
actggacaagacatccgagccactggtgttcccaatcctcttgcttacgtgccaacagta
acatcggagttgtcagatcggatgacatttttgcagagactgaagaatgtgctggtttac
ttcgcagctactactatgggacagctggtcgtggataagagttacgacgatctcgcaaaa
agaaccattggcgacagcttcaccatgtctgctgccttggcaagaaccgacgtgtggctc
taccaatcagatctcatgtttgactttcctaaacccatgatgccaaatatggtcagcata
gctggtcacatggctgaggatgtcaagccgctcagtgaggagctggagaagtttgtgcag
agttctggagatgacggtgttgtgcttgtaacgttcggctccttggtagcagctatgcct
gcagacatagccgacatgctggccgctgcttttgcccgtctgccacagaaggttgtgtgg
cgctacgctgggacgccacctccaagtctggggccaaacaccaagaccatggagtgggtg
cctcaaatcgacttactagctcatcctaagacaaaggcgtttgtatcacattgtggctac
aacggagtagcagaggctatgtaccacggggtgcccctggtcggcatgcctttgtttgcc
gaacaattcgataacattgcccggatggtggcccgtgggatggcggtgtcattggacatc
cacacggtgacgtcagaggaggtttaccgggctattactaccgttatttcggatcctagt
ttcaaggagaaggccaatcagatctccacgcatcttcgtgaccaaccacagtcgcccatg
gagcgggcagtatggtggatagaacacgtcatcaaacatggcggccttccccatctcagg
tcgagagcacccgaactccccttctaccagtactacctgttagacgttattgccctgatt
gttgcagttatatctgctgtattgttgtcttgttggaagtgctgttcgtttgcatgtaat
atgtgcaaaaagggtaccaccatcaccaaaaagaaagtcaactga

DBGET integrated database retrieval system