KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_84433Help
Entry
BRAFLDRAFT_84433  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 381 aa AA seqDB search
MQGSETVESKNRSFLKKRSLDISFNVDSKYSPVENIGIGAYGVVCSAINKKNGRKVAIKK
IPNAFDVLMTAKRTYRELKILRHFKHDNVIGIHEVLRPADAKTNDVKDVYVVFDLMESDL
HHIIHSDQDLTDEHIRYFLYQILRGLKYIHSANVLHRDLKPSNLLVNENCELKIGDFGMA
RGVSSSPNDYKAFMTEYVATRWYRAPELMLSLNEYTFAIDVWSVGCIFAEMLGRKQLFPG
KNYLNQLNLIMSVLGTPPDSIIQSVTAERVRHYMSNIPKRRPVPWSVLYPQKSKEALCLL
SKMLNFNPKERISVEDALSHPYLSKYHDPDDEPICIPAFDFDFERRTMTRDQIKQAILSE
IDEYEKSPTLRISKPIIDTDL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggtcagagacagtggaatctaagaaccgtagcttcctcaagaagcgaagcctg
gacatcagtttcaatgtagacagcaagtattcacctgtcgagaacatcggaattggtgcg
tacggtgtcgtctgttcggcaatcaacaagaaaaatggcagaaaagtcgccattaagaaa
ataccgaatgcttttgatgtgttgatgacggccaagagaacgtacagggaactcaagata
ctgcgtcacttcaagcatgacaatgttatagggatccatgaggttttgcgcccagcagac
gcaaaaacaaacgatgttaaggatgtttatgttgtctttgacttgatggaaagtgacctg
caccatatcattcactcagatcaagacttgacggatgaacacattcggtactttctgtac
cagattctccgcggcctgaagtacatccattctgctaacgttctgcacagagacctaaag
cccagtaatctcctcgttaacgagaattgtgagctcaaaattggtgattttggcatggca
aggggggtgtcgtcaagccctaatgactataaagcatttatgacagagtatgttgctacc
aggtggtacagagcccctgagctaatgctgtccctgaatgagtacacctttgcaatagac
gtgtggtcagtcggatgcatctttgctgagatgttgggtagaaagcagctctttccgggg
aagaattacttgaaccagctgaatctcatcatgtccgtcttgggaacacctcctgacagc
atcatccaatcagtgactgcagaaagagtccgacactacatgtccaacatccccaagcga
cgacccgtcccatggagtgtcctgtatccacagaagagcaaggaggcactatgtctgctc
tccaagatgctcaacttcaatccgaaggagcgaatttcagtcgaagacgctctctctcat
ccttacttgtccaagtaccatgatcctgacgatgagccaatctgcatccctgcctttgat
tttgactttgagagacgaacaatgacaagagaccaaatcaagcaggccattctaagcgaa
attgacgaatacgagaagtcaccgacgctgagaattagcaagcccataattgatacagat
ttgtga

DBGET integrated database retrieval system