KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_84433Help
Entry
BRAFLDRAFT_84433  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     BRAFLDRAFT_84433
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   BRAFLDRAFT_84433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 381 aa AA seqDB search
MQGSETVESKNRSFLKKRSLDISFNVDSKYSPVENIGIGAYGVVCSAINKKNGRKVAIKK
IPNAFDVLMTAKRTYRELKILRHFKHDNVIGIHEVLRPADAKTNDVKDVYVVFDLMESDL
HHIIHSDQDLTDEHIRYFLYQILRGLKYIHSANVLHRDLKPSNLLVNENCELKIGDFGMA
RGVSSSPNDYKAFMTEYVATRWYRAPELMLSLNEYTFAIDVWSVGCIFAEMLGRKQLFPG
KNYLNQLNLIMSVLGTPPDSIIQSVTAERVRHYMSNIPKRRPVPWSVLYPQKSKEALCLL
SKMLNFNPKERISVEDALSHPYLSKYHDPDDEPICIPAFDFDFERRTMTRDQIKQAILSE
IDEYEKSPTLRISKPIIDTDL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggtcagagacagtggaatctaagaaccgtagcttcctcaagaagcgaagcctg
gacatcagtttcaatgtagacagcaagtattcacctgtcgagaacatcggaattggtgcg
tacggtgtcgtctgttcggcaatcaacaagaaaaatggcagaaaagtcgccattaagaaa
ataccgaatgcttttgatgtgttgatgacggccaagagaacgtacagggaactcaagata
ctgcgtcacttcaagcatgacaatgttatagggatccatgaggttttgcgcccagcagac
gcaaaaacaaacgatgttaaggatgtttatgttgtctttgacttgatggaaagtgacctg
caccatatcattcactcagatcaagacttgacggatgaacacattcggtactttctgtac
cagattctccgcggcctgaagtacatccattctgctaacgttctgcacagagacctaaag
cccagtaatctcctcgttaacgagaattgtgagctcaaaattggtgattttggcatggca
aggggggtgtcgtcaagccctaatgactataaagcatttatgacagagtatgttgctacc
aggtggtacagagcccctgagctaatgctgtccctgaatgagtacacctttgcaatagac
gtgtggtcagtcggatgcatctttgctgagatgttgggtagaaagcagctctttccgggg
aagaattacttgaaccagctgaatctcatcatgtccgtcttgggaacacctcctgacagc
atcatccaatcagtgactgcagaaagagtccgacactacatgtccaacatccccaagcga
cgacccgtcccatggagtgtcctgtatccacagaagagcaaggaggcactatgtctgctc
tccaagatgctcaacttcaatccgaaggagcgaatttcagtcgaagacgctctctctcat
ccttacttgtccaagtaccatgatcctgacgatgagccaatctgcatccctgcctttgat
tttgactttgagagacgaacaatgacaagagaccaaatcaagcaggccattctaagcgaa
attgacgaatacgagaagtcaccgacgctgagaattagcaagcccataattgatacagat
ttgtga

DBGET integrated database retrieval system