KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_84516Help
Entry
BRAFLDRAFT_84516  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:bfo04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 422 aa AA seqDB search
MLEEEVYGTNSPIWDPDFNQVPANMPLSSTLSAGQGDIPIETIQKVLATITDPAAMVGPE
ASVFSAHAARDEAARLEERRGVIEFHVVGNSLGQKPSKQTITWLIGLQNVFSHQLPRMPK
EYITRLVFDLKHRTLALIKDNRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMN
HLKDYHVKHGVYHFLTFADEFAIGYFKKQGFSKEIRLPASAYMGYIKDYEGATLMGCELN
PQIPYTELSQVIKKQKDVLKKLIEEKQEQIGRVYPGLTCFKDGVRQIPVESIPGIRSTGW
KPKDLRGKDQNKDSEQLFTVLKTLLTQVKNHASAWPFVRPVEKTEAPDYYEHIKYPMDLK
TMGERLKNRYYCSKKLFIADMQRIFTNCRAYNSPDTEYFRCANTLERFFMNKLKELNLEK
EQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagaagaggtttatggcaccaactcccccatctgggatcccgacttcaaccaa
gtcccggctaacatgccgctgtcctccacactttcagcaggacaaggagacattccaata
gaaaccatacagaaagtcttggccactatcacagaccctgcagcaatggtaggtcccgag
gccagcgttttttcggcacacgcagcacgagacgaagctgctcggctggaggagcgccgc
ggggtgatagagttccatgtggtcggcaactccctgggtcagaagccgtccaaacagacc
attacctggctcatcggactacagaatgtgttctctcaccaactgccacgtatgcctaaa
gagtacatcaccaggctggtctttgacctgaagcacagaaccctggctttgatcaaggac
aaccgtgtaattgggggcatctgtttccgcatgtttcccacccagggcttcacagaaatt
gtgttctgtgccgtcacatctaatgaacaagtcaagggttatgggactcatctcatgaac
cacctgaaggactaccatgtcaaacatggcgtctaccactttctcacattcgctgacgag
tttgctatcggttactttaagaaacaggggttttccaaggagatccgcctgcctgcgagt
gcctacatggggtacatcaaggactatgaaggtgcaacactgatggggtgtgagctgaac
ccacagatcccctacactgaactgtcacaggtcatcaagaaacagaaggatgtgctgaaa
aagctgatagaggagaagcaggagcagatcgggagggtgtacccggggctaacctgcttc
aaggatggggtacgccagataccggtggagagtatacctggaatacgttccacaggatgg
aaaccaaaggaccttagggggaaggaccagaataaggacagtgagcagctgtttacagtg
ctgaaaaccctgctgacccaagtcaagaaccatgccagtgcctggccgttcgtccgacca
gtggagaagactgaagctccggactactacgagcacatcaagtatcctatggatctgaag
accatgggagagcggctgaaaaatcgctactactgttccaagaagctcttcatagccgac
atgcagagaatcttcacaaactgtcgagcatacaacagtccggacacagaatatttccgc
tgtgccaacacactggaaagatttttcatgaacaaactgaaagagctgaatctagagaag
gaacaatga

DBGET integrated database retrieval system