KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_84578Help
Entry
BRAFLDRAFT_84578  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K16857  
thrombospondin 1
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Phagosome
TGF-beta signaling pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    BRAFLDRAFT_84578
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    BRAFLDRAFT_84578
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    BRAFLDRAFT_84578
Heparan sulfate/heparin binding proteins [BR:bfo00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  BRAFLDRAFT_84578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1158 aa AA seqDB search
MYDLFESTSLGASTQGVKKVRGLDQYSPAYKFHNRPDVDLPASPQAQARIVDAMMSNHGF
VFVAALRQDRRNRGTLVSVDSPDGRTRYFGIQSDGQTPSVDVVYMHEGKEVAASFDGVNF
ATREWRNLTLVVQGDLIALFDGCTKVGEQGLMGNIFQTVLQPGQSELRLGKGLPGREAFE
DYRGVMQSVKFIFGIPVSNILHLQGCAPDTGSEYNTGNITQTAAAVSSVLTRKFKLIPQP
SDECEVACEDLDDLKKQIKDLRIHLNNVEDGLQKMWEENNILRKQIGAPPHGGCWAEGRY
YGNNVHWVENRCTKCHCQDSRTTCQKIECRAVQCVNPVFDSETDCCPYCPLSGDDAEVGW
SLWSDWTPCSASCGPGTQQRGRSCDRVNYPCDGPSVETKVCLQDDCDNRIPMNGGWSLWT
PWTCSVSCGEGITTRIRTCNAPTPQLGGENCLGDGRENNICEREACPVHGQWGQWSLWGP
CSRTCDGGTRVRRRLCDSPAPAYGGDKCQGQPADVDHCNTEPCPIDGCLSNPCFAGVECS
STKDGKYTCGPCPAGFEGDGSSCTDIDECALVPDTCYIHNGVSLCKNLGPGYRCQRCPPG
YTGNQPGGVGIFMAESNKQTCLPANPCRDGTDQCHFNAECKFLGPFIDPLYECQCKVGYA
GNGIHCGEDIDLDGYPDEDLPCLIGNTTHCKKDNCPFLPNSGQEDFDKDGKGDACDRDDD
NDGIPDVRDNCPMAFNARQDDYDRDGWGDLCDNCPYDQNFYQKDTDGNGEGDACSVDIDG
DGLRNEADNCPLHANIRQEDADGDGVGDQCDNCPVIANPKQEDSDSDLWGDACDNNIDVD
DDGLENIRDNCPSIPNSNQINHDGDNFGDACDEDDDNDGILDHLDNCRLRANPDQIDSNG
DGRGDVCQEDFDGDGVKDKDDVCPENAQISRVDFRDFQMVALDPKGTSQIDPNWVIRNQG
KELVQTVNSDPGMAIGIDKFNEVDFDGTFYVNTQKDDDYAGFVFGYQSSHRFYVVMWKQV
HQTYWLSKPSMAHGSAGVQVKVVNSETGPGEALRNALWHTGDTPGQVRLLWHDKNTTGWK
DMTAYRWKLKHRPDSGLIRVTFYEGSKVMADSGDLFDTTLKGGRLGLFVFSQEMVFFSDL
KYNCGQSALGEMKGSESP
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacctgtttgaatcgacgagtctcggggcgagcacacagggagtgaagaaagtg
cgggggctcgatcagtattcaccggcctacaagttccacaaccgtcccgacgtcgacttg
cccgccagcccccaggcgcaggccaggatcgtcgacgcgatgatgtcgaaccatggcttt
gtgttcgtcgcggcccttcggcaggaccggcggaaccgtggcacgctcgtgtccgtcgac
tcgcccgacggcaggaccagatacttcggcatccagagtgacggccagacgccctccgtg
gacgtcgtgtatatgcatgaaggcaaggaagtcgcggcctcgttcgacggcgtgaacttc
gccacgcgggaatggcgcaacttgacgttggtggtgcagggagacctgatcgcgctgttc
gacggatgtaccaaggttggcgagcagggcctgatggggaacatcttccagaccgtcctc
cagcccggacagagcgagctccgtctggggaagggcctacccggcagggaagccttcgag
gattacaggggtgtgatgcagagtgtgaagttcatctttggaatcccggtgtccaacatc
ctccacctgcagggctgtgctcccgacacagggtcagaatacaacacgggtaacatcacc
cagactgctgctgcggtgagcagtgtcctgacgaggaagttcaagctcatcccccagcct
tcagacgagtgtgaggtcgcctgcgaggacctggacgacttgaagaaacagatcaaggac
ctgaggatccacctgaacaatgtggaagatgggctgcagaaaatgtgggaagagaacaac
atcctgaggaaacagatcggtgctcctccgcatggtggatgctgggcagaaggacgttac
tatggcaacaatgtacattgggtggagaaccgctgtaccaagtgtcactgtcaggattcc
agaactacatgtcagaagatcgagtgccgtgcggtccaatgtgtcaacccagttttcgac
agtgagactgactgttgcccatactgccctctcagtggagacgacgcggaggtcggatgg
agcctgtggtctgactggacaccgtgcagcgcttcttgcggacctggcacccagcagcga
ggccgatcatgtgaccgtgtcaactacccctgtgacggccccagtgtagagaccaaagtg
tgcctgcaggacgactgtgacaacagaattcccatgaatggaggctggagcttgtggact
ccctggacctgctctgtgtcctgtggggagggcatcaccactcgcatcaggacctgcaat
gcacccactccacagctaggtggcgagaactgtcttggagatggacgagagaacaacatt
tgcgagagggaggcatgccctgttcacggccagtggggtcagtggtcactgtggggccca
tgctcgcgcacctgtgatggaggcaccagggtccgccgccgtctctgcgacagtcccgca
ccagcgtacggaggggacaagtgccagggccagcctgctgacgtggaccactgcaacacc
gagccttgccccattgatggttgcttatccaacccctgctttgccggagtggaatgttcc
agtaccaaggatggcaagtacacgtgtggtccctgtcccgctggcttcgagggtgacgga
tcttcttgcactgacattgatgagtgtgcactggttcctgacacctgttacatccacaac
ggagtgtccctgtgtaagaacctggggccaggctacaggtgccagaggtgtcctcccggc
tacacaggaaaccagccaggtggagtgggcatcttcatggcagagagcaacaaacagacc
tgcctgcctgccaacccctgcagagatggtactgaccagtgccacttcaacgctgagtgc
aagttcctgggaccgttcatagatcccctgtacgaatgccagtgcaaggttggatatgct
gggaacggcatccactgtggtgaggacatcgacttggacggttatcctgacgaggatctg
ccctgtttgatcgggaacacaacgcactgcaaaaaggacaactgcccattcctacccaac
agtggtcaggaggactttgacaaggatgggaagggtgatgcttgtgacagagatgatgat
aatgacggcatccctgatgttagggacaactgcccgatggcgttcaatgccagacaggac
gactacgaccgtgatgggtggggagacctgtgtgacaactgcccctacgaccagaacttc
taccagaaggacacggatggcaatggagagggagatgcctgctctgtggacatagatggt
gatggactgaggaatgaagctgacaactgccccctgcatgccaacatcagacaggaggat
gctgatggtgacggtgttggagaccagtgcgacaactgccctgtcatcgcaaaccccaaa
caagaggactctgactccgacctgtggggcgatgcctgcgacaacaatatcgatgtcgat
gacgacggtctggagaatatccgtgacaactgcccgagcatccccaacagtaatcagatc
aaccatgatggcgacaattttggtgatgcgtgtgatgaagatgatgacaatgacggtatt
ctggaccatttggacaactgcagactccgtgcaaacccagaccaaatagacagcaacggt
gacggacgtggagacgtttgccaggaagactttgacggtgacggtgtcaaggacaaggat
gatgtgtgcccagagaatgcgcaaatctccagggtagacttccgtgacttccagatggtt
gcactggatccaaagggaacatcccagattgaccccaactgggtcatcaggaaccaaggg
aaggagctggtgcagacagtcaacagtgatccaggcatggcaataggaattgacaagttc
aacgaagtggactttgacggcaccttttatgtgaacacgcaaaaggatgatgactacgca
ggctttgtatttggctaccagtccagccatcggttctacgtggtgatgtggaaacaggtc
caccagacgtactggctgtccaaaccttccatggcccacggctcagcaggagtccaagtc
aaggtggtaaactcggagacaggaccaggtgaggccctgaggaatgccctgtggcacact
ggagacactcccggacaggtgaggctgctgtggcacgacaagaacaccactgggtggaaa
gacatgaccgcctacagatggaagctgaagcacagaccagactctggactaataagggtg
acattctatgaaggcagtaaagttatggctgactctggggatctattcgacacaacatta
aagggaggtcgcctaggacttttcgtcttttcacaagagatggtcttcttctcggatctg
aagtacaactgtggtcagtcagccttgggggaaatgaaaggaagtgaaagtccttaa

DBGET integrated database retrieval system