KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_85797Help
Entry
BRAFLDRAFT_85797  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00511  Other glycan degradation
bfo00600  Sphingolipid metabolism
bfo01100  Metabolic pathways
bfo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BRAFLDRAFT_85797
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BRAFLDRAFT_85797
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    BRAFLDRAFT_85797
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BRAFLDRAFT_85797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 7241042
NCBI-ProteinID: XP_002601629
JGI: 85797
UniProt: C3YQ03
AA seq 644 aa AA seqDB search
MALREGKLSTYLFFVYLAFMFSHLALDVHGANECVEKPFPGQSFVCVCNSTYCDGIEPNT
RVQLPQFNLYRTSKAKERFSKKILTFTKTVPQTKNIWVVNRNVSYQKIKGFGGAFTDAAT
INIMSLSKLTQDKLIAAYFSPKEGIEYTIGRVPMAGCDFSTREYTYADTPQDFQMDKFAL
TEEDLEYKIPVIKRALSMSSRNISLFGSPWSAPAWMKTDDSLTGKGTLIGQAGDKYHRAW
ALYFAKFLEEYKKQGLEFWGLTAQNEPADGMITKFSFNCMGWTAESQRDWIAADLGPTLE
ERGHGDVSLMMLDDNRIWLPAWADTVLQNATAAKYVKGVGVHWYLNSLVPPLTLSATHER
HPDYFILATEACSGSFPWGRHVLLGSWDRGEDYTHDIIQNLKNWVVGWVDWNLALNGTGG
PNWANNFVDAPIIVNSGKDEFYKQPMYYHLGHFSKFIPAGSFRIDVKPESSNPGNLDVVA
FLTLEKSVVAVIFNRVSSMMVGSGRVLVLCAAVAVCLVQHLQPATAERKPCIAKDFQHGG
FVCVCNATYCDTMEPNTKLPKGQAAMYVSTPSGKRFEKIVLNFTAKSNDSGDYDVWTVMK
NITYQKIKGFGGAFTDAATMNILSLSEGAQKNLISAYFSPTEGV
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggcgctacgcgagggaaaattgtcaacatacctgttctttgtttatttggcttttatg
ttctcacatcttgcactagatgtccatggtgccaatgaatgtgtagagaagccatttcct
ggccagtcgtttgtatgcgtctgcaattccacgtactgtgatggtattgagcctaacacc
agggtacaacttcctcagtttaacctgtacagaacttctaaagcaaaggagaggttcagt
aagaaaatactaacatttacaaagacagtgcctcaaacaaaaaacatctgggtggtcaac
aggaatgtatcataccagaagataaagggctttggtggtgccttcactgatgctgccact
atcaacatcatgagcctgtccaaactgacacaagacaagcttattgctgcttacttcagt
cccaaagaaggaattgagtacaccataggaagagttcccatggcaggatgtgacttttcc
actagagagtacacctatgctgacacacctcaggatttccagatggacaagtttgctctg
actgaggaagacctggagtacaagattccagtcatcaagcgtgccctatccatgagttcc
aggaacatttctttatttgggagcccatggagtgcacctgcttggatgaaaactgatgac
agcctcactggaaaggggactctgattggccaggctggagacaagtaccacagggcatgg
gcactgtactttgcaaaatttctggaggaatacaagaagcaaggtttggagttctggggc
ctgacagctcagaatgaaccagcagatggcatgatcacaaagttttccttcaactgtatg
ggctggactgcagaaagccagcgtgactggatagcagcagacctggggcccacactagag
gagagaggacatggggacgtcagtctcatgatgctggatgataacaggatctggctacct
gcctgggctgacactgtattacagaatgccacagctgccaagtatgtgaaaggtgtggga
gttcactggtacctgaactcccttgtcccaccactgactctcagtgctacccatgagcgc
caccctgactacttcatcttggccacagaggcctgtagtgggtccttcccctggggcaga
catgtcctcctggggagttgggacaggggagaggactacacacacgacatcatccagaat
ctgaagaactgggttgtaggctgggtggactggaatttggccctaaatggcactggtggg
ccaaactgggccaacaactttgtggatgctcccatcattgtaaactcaggcaaagatgaa
ttctacaagcaacccatgtactaccacctaggacatttcagcaaattcatcccagcgggc
tcctttagaattgatgtcaaaccagagtcgtccaaccctgggaacctggatgttgttgca
ttcctaacgcttgagaaaagtgttgtggcagtcatatttaacagggtaagcagcatgatg
gtggggagtgggcgtgtccttgtgctgtgtgctgcggtggctgtatgcctggttcagcac
ctgcagccagcaactgcagagcggaagccatgcatagccaaagatttccaacatggtggt
tttgtgtgtgtctgtaatgccacctactgcgacaccatggagcccaataccaaactacct
aaaggccaggctgccatgtacgtgtccaccccaagtggcaagaggtttgagaagattgtc
ctcaacttcactgccaagtctaacgactctggtgactacgacgtttggaccgtgatgaag
aacataacataccagaagatcaagggatttggcggtgccttcactgatgctgcgactatg
aacatcttgagtctatctgagggcgcacagaagaacctcatctctgcttacttcagtccg
actgaaggtgtgtga

DBGET integrated database retrieval system