KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_86149Help
Entry
BRAFLDRAFT_86149  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
mTOR signaling pathway
Jak-STAT signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    BRAFLDRAFT_86149
   04150 mTOR signaling pathway
    BRAFLDRAFT_86149
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    BRAFLDRAFT_86149
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BRAFLDRAFT_86149
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   BRAFLDRAFT_86149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1400 aa AA seqDB search
MLSQFVAGLKSRNEESRTKAAKDMQHYVTTELREMSAEENTAFMDELNHDIFEMVSSSDA
NEKKGGILAIVSLIGVDGGSSSTRISRFANYLRNLLPSNDPVVMEMASQAVGRLALAGGT
FTAEYVEFEVKRAIEWLQGDRHEGRRHAAVLVLRELAVSAPTFFFQQVQPFFDNIFNAVR
DPKQAIREGAVAALRACLVLTSQRETKEMQKPQWYRQTYEEAEKGFDDSAGKERGVNKDD
RVHGSLLIINELIRNSSMEGERLRQEMEEISQQQVQHDQQKPIKEFSFLGFKSSKSLTSH
SSQHSNSHTTVATFQGQRSMLSSLGMGMRGAQVQGKPVNVESRYCRELMESKFELVCQQV
LKYRTSRNVLLQQVLLQLLPRLAAFQPQRFVQSYLTDTMSYLLGCLKKERERSTAFQAVG
LLAVAVRQEVIAYLNRILDVVRISLPSKETPHKRHKNFVVDPSVFTCVSMLARAVGPCIA
KEVKELLEPMLAVGLSPALTAALHDLAHQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMP
QKFTPSLTPSASFSNIQDANDVTNTVLALRTLGSFDFEGHSLTVFVRHCADHFLASEHKE
IRMEAARTCSHLLSPSIHLLGNHHGHPSYTQTQVVADVLSKLLVVAITDTDPDIRYCVLA
SLDERFDGHLAQAENLSALFVALNDEVFEIRELAICTIGRLSSLNPAFVMPSLRKTLIQI
LTELEHSGVGRNKEQSARMLGHLVANAPRLIRPYMEPILKSLVPKLKDPDPNPGVIISVL
STIGELAQVGGLEMKKWVDELCPIILDMLQDSSSLAKREVALWTLGQLVECTGYVVEPYT
KYPSLLEVLLNFLKTEQAPGIRREAVRVLGLLGALDPYIHKVNTGVIDRSSDSGAVVSLS
DTKSSPESGESAAEMLVNMGGCPLEEFYPAVAIATLMRILRDPSLSNHHTMVVQAITFIF
KSLGMKCVQFVPQIMPTYLNVIKTCDANVREFLFQQMGMLISIIKQHIRNYLDDIFTIIK
EYWTPNSPMQNTIILLVEQIVVALGGEFKVYLPQIVPQILKVFMHDSSPGRGVTVKLLNA
MQMFGANLDDYLHLLLPPVVKLFDSPDIPTSVRRAALETIDRLTDNLDLTDFASRIIHPL
VRILDVVPELRPVAMNTLSSLVMQLGKKYQIFIPMVHKVLMRHRISHQKYDILSCRIIKG
STIAEEEDDPLLYRPRQNKGNLAEDSGSSTIEATTVKKLHVSTSNLQKAWGASRRVSKDD
WMEWLRRLSVELLKESPSPALRSCWALAQAYNPLARDLFNAAFVSCWSELHEQQQDELVQ
SIEVALTSQDIPEITQTLLNLAEFMEHSDRGPLPLKDDNGIVLLGGRATKCRAFAKALHY
KELEFHKGPNTDVLEALIRD
NT seq 4203 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgcagtttgtcgccggcctgaagagtcgcaatgaagagtctcggacgaaggct
gcgaaggacatgcagcactacgtcaccacggagctgcgcgagatgtctgcggaggagaac
accgccttcatggacgaactgaaccacgacatctttgagatggtgtcaagttctgatgct
aatgagaagaaggggggcattctggccatcgtgagcctgattggtgtagatggtggcagt
agctcgacacgtatcagtcggtttgccaactacctgcggaacctcctgccctccaatgac
cccgttgtcatggagatggcctcacaggctgtgggtcggctggcgctggccggagggacc
ttcacggcggagtacgtggagtttgaagtgaagagagccatcgagtggttacagggagat
cgacatgaaggcagaagacatgctgcagttttggttctcagagagcttgctgtgagtgcc
cccacgttcttctttcaacaagtgcagcctttctttgacaacatcttcaatgctgtacga
gaccctaaacaggccattcgcgagggtgcagtggcagcactgcgtgcctgtctggtactc
acttcacagagggagactaaagagatgcagaaaccacagtggtataggcaaacctatgag
gaagcagagaagggctttgatgattctgctgggaaggagcgaggagtgaacaaagatgac
cgtgtccatgggtcactgctgatcattaatgaactcatcaggaacagcagtatggaggga
gagcgcctacgacaggagatggaggagatcagtcagcagcaggtccagcatgaccagcag
aaacccatcaaggagttctccttcctcggattcaagtcctccaagagcctgaccagccac
agcagccaacacagcaactcccacaccaccgtggccaccttccaggggcagcggtccatg
ctgtcctccctggggatggggatgaggggggcgcaggtgcaggggaagcctgtcaatgtg
gagagcaggtactgcagggaactcatggagagcaagtttgagctggtgtgtcagcaggtg
ctgaagtataggaccagcaggaatgtgctgctgcagcaggtgttgctccagctgctgccc
cgcctggccgccttccagcctcagagatttgtccagtcgtacctgacagacaccatgagc
tacctactggggtgcctgaagaaagaacgggaacgctcgacagctttccaggcagtcggc
ctgctggccgtggccgtacgacaggaagtcatcgcctacctgaaccggatcctggatgtg
gttaggatatcactgccgtcgaaggagacaccacacaagaggcacaagaactttgtggtg
gacccctctgtgttcacctgtgtgagtatgctggcccgtgctgtaggaccctgcatcgcc
aaggaggtgaaagaactgttggaacccatgttggctgttggcctaagccctgcgctgact
gcagccctgcacgacctggcccatcagatcccacagctgaagaaggacatccaggacggg
ctgctgaagatgctgtccctggtcctcatgcacaaacctctccgtcatcctggcatgcca
cagaagttcactccttccctcactccatctgcttccttctcaaacatccaggatgccaat
gatgtgacaaataccgttctggcactgagaactctgggtagctttgactttgaaggccac
tccctgacagtgtttgtgcgacactgtgccgaccacttcctggccagcgagcacaaggag
atccggatggaggcagcccgcacctgttctcacctgctgtctccttccatacatttgctg
ggtaaccaccatggccatcccagctacacacagacccaggtggtggctgatgtcctcagt
aagctgctagtggtggccatcacagacacagaccctgatatccgttactgtgtgctggcc
tcgctggatgagaggtttgacggacatctggcgcaggcggagaacctgagcgccctgttt
gtggctctgaacgatgaggtgtttgagatccgtgagctggccatctgcaccatcggccgc
ctcagtagtctcaatcctgcctttgtcatgccttcactcaggaagactcttattcagatt
ctgactgaactggagcacagtggtgtgggcagaaacaaggagcagtcagcgaggatgctg
ggacatctggtggctaacgccccacgactcatcaggccttatatggaacccatcctcaag
tccctggtacccaagctgaaggaccctgaccctaaccccggggtgatcatcagtgtcctg
tccaccatcggggagctggctcaggtgggggggctggagatgaagaaatgggtggatgag
ctctgtcccatcatactggacatgctgcaggactcctcatccctcgcaaagagagaggtg
gctctgtggaccctgggccagctggtggagtgtaccgggtatgtggtagaaccctacaca
aagtacccatcactgctggaggtactgctcaacttcctcaagactgaacaggctcctggc
atcaggagagaggctgtgagggtactgggtctactaggtgcccttgacccctatattcac
aaggtcaacacaggcgtgattgacagatccagtgactctggtgcagtggtcagcctgtct
gacaccaagtccagcccagaatcaggagagtcagctgcggagatgcttgtgaacatggga
ggctgtcccctggaggagttctacccagcagtcgccatagcaaccctgatgcggatcctg
agggacccatccctctccaaccaccacaccatggtggtccaggccatcaccttcatattt
aagagcctggggatgaagtgtgttcagtttgtgcctcagatcatgccgacatatctcaat
gtgatcaagacatgtgatgccaatgtcagagagttcctattccagcagatggggatgctg
atctccatcatcaagcagcacatcaggaactacctggacgacatcttcaccatcatcaag
gagtactggacccccaacagccccatgcagaacaccatcatcctgctggtggagcagatt
gtcgtggctctgggaggggagttcaaggtgtaccttccccagattgtccctcagatccta
aaggtcttcatgcacgacagcagccctggaagaggagtcactgtaaagctgctgaatgcc
atgcagatgtttggagccaacctggatgactacctgcacctgctgctgccacctgtcgtc
aagctgtttgactcaccggacattcccacctctgtcagaagagctgccctggagaccatt
gaccggctgactgataacctggacctgaccgactttgcctctcggatcatccaccccctg
gtgcgcatcctggacgtggtgccggagctccgccctgttgccatgaataccctgtcctcc
ttggtgatgcagctgggcaagaagtaccagatcttcattcccatggtgcacaaggtgctg
atgcggcaccgcatctcccaccagaagtatgacatactcagctgcaggatcatcaagggg
tcgaccatagctgaggaggaggatgaccccctcctgtaccgccccaggcagaacaagggg
aatctggccgaggactcgggtagcagtacgatcgaagccaccactgtcaaaaaactccac
gtcagcacatccaacttacaaaaggcctggggtgcgtctcgtcgtgtgtccaaggatgac
tggatggagtggctgcggaggctgagtgtggagctgctgaaggaatccccctcccctgca
ctacggtcctgctgggcactggctcaggcatacaatccactggccagggatctgttcaat
gcggcgtttgtgtcatgttggtcggagctgcacgagcagcagcaggacgagctggtacag
agtatcgaggtggcgctgacgtcccaggacatccctgagatcacacagaccctgctgaac
ctggctgagttcatggagcacagcgacaggggtcctctccctctgaaagatgacaatgga
atcgtccttctgggtggccgtgccaccaagtgtcgagcatttgccaaggccctgcactac
aaggagctggagttccacaaaggtcccaacacagacgtcttagaagctcttatcagagat
tga

DBGET integrated database retrieval system