KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_86371Help
Entry
BRAFLDRAFT_86371  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    BRAFLDRAFT_86371
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    BRAFLDRAFT_86371
   04068 FoxO signaling pathway
    BRAFLDRAFT_86371
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     BRAFLDRAFT_86371
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   BRAFLDRAFT_86371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 209 aa AA seqDB search
MSKLAANSQFYTVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDTLTGQNVAIKKLSRP
FQNVTHAKRAYREFVLMKLVNHKNIIGLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQ
MDLDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYTENGNYK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagctggcagcaaacagccagttttacacagtggaggttggagacagcaccttt
acagtactgaagcgatatcagaacctcaaacccatcggttcgggggcgcagggcatcgtc
tgcgctgcgtacgacacgctaacgggacagaatgtagcgattaagaagctgagtcggccg
tttcagaacgtcacacacgccaagcgagcgtaccgggagttcgtgctcatgaaactcgtc
aatcataaaaatattataggactgttaaatgtcttcaccccgcagaagtcgttagaagaa
ttccaagatgtgtacctggtgatggagttgatggatgcgaacctgtgtcaggtgattcag
atggatctggaccacgagcgcatgtcctacctcctctatcagatgctgtgtgggatcaaa
cacctgcactcggctgggatcattcacagagacttgaaacccagcaatatcgtggtgaag
tcggactgtacgctgaagattcttgacttcgggctggcgagaacggcgggaacaagcttc
atgatgaccccttacgtggtgacgcggtactacagggcacccgaggtcatcctgggcatg
gggtacaccgaaaacggtaactacaagtag

DBGET integrated database retrieval system