KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_86500Help
Entry
BRAFLDRAFT_86500  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BRAFLDRAFT_86500
Enzymes [BR:bfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BRAFLDRAFT_86500
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_86500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 197 aa AA seqDB search
ILRENGTINNEASTQRLAEVALAYAQAGCQIIAPSDMMDGRIAAIKESLRSHGLGNSVSV
LSYSAKFASSFYGPFRDAAKSAPAFGDRKCYQLPPGSRGLAIRAVERDVREGADMLMVKP
GMAYLDIVRDTKNKFPNHPLAIYQVSGEYAMLYHGAQAGAFDLKTIVMEVLTGMRRAGAD
IIITYYTPLLLDWLQEQ
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
attttaagagagaatgggaccataaacaatgaagccagcacacaacgactggctgaggtg
gcactggcttatgctcaggctggttgccagattattgctccctctgacatgatggacgga
cggatagcagccatcaaggagtccctcaggtcacatggactgggcaacagtgtgtctgtt
ctgagctacagtgccaagtttgcctccagtttctatggaccattcagagacgcagccaag
tcagccccagcgtttggagacaggaagtgttaccagctgcctccaggctccagaggactg
gccatcagggctgtggagagggatgtacgggaaggagcagacatgctgatggtcaaacct
ggcatggcctacctggacatcgttagggacactaagaacaagttcccgaaccatcccctg
gccatctaccaggtgtctggagagtacgccatgttgtaccacggagcccaggctggggcc
ttcgatctgaagactattgtcatggaggtgctgactggcatgaggagggcaggtgcagac
atcatcatcacctactacacccccctgctgttggactggctccaggaacagtaa

DBGET integrated database retrieval system