KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_86594Help
Entry
BRAFLDRAFT_86594  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K12378  
tyrosine-protein kinase receptor torso [EC:2.7.10.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1046 aa AA seqDB search
MAFGQSSFWPCRVAVSSVPSQLSTPRLICNGRDPTYWDPTYWEYSGYIILKWSLSVTRDL
PPATRRAVYYVVRQRSRYLENRRWHVSDWDVVGKAHTMDGTVHIRTLTPGANYQFEVTAV
LPDGKTGASVLGQWITPRPATVRPRANPPSDLRVENKRFKNGNVSVTIAWTPPEDLPCEY
SLHLLTDTSIADTPVRIDRPVETRYTFHNLTFDSNYTVLMRSTFYEGATESRAVSMWFQT
PHCLDVSGYNFSVCAPGAPRNLTYRLSVTDNVAIVSWLPPFRTSRTNPVSSYVVLVRQEV
QPAVDGTILSAQATQEVIPGVGHTVTTVHVCEIQKGLGSLRLEVGMVGSRLLLIRPYVGK
KDPTTTVLTSPTMIAGSSPMPLFPESPVFHGLRHDHCFLLQNRFYSETDVLSDQHDEYEM
DFSQLELEEVIGEGAFGKVIRGKARGLPTMPNTPIATVAVKTLKENATGVDQANLLAEIE
LMKQIGANRNIVSILGCCTRRSPVFLVVEYCPFGDLKNLLRNIREQKEYEENEHPLLGIK
CQAINSPNMGNNEEASFAPVTVSSLVPIYNPASEANPSAAGGRPKDENLDSGTSMDLRDV
LDVLPTDLLSFARQISTGMEYLASKKFVHRDLAARNVLVCENKVVKISDFGLTRDIYENS
EYRKLTGGKLPVRWMSPEAIFDQVYTTQSDVWSFGVVLWEIVTLGGSPYPGLSGKELFRY
LKAGYRMEKPENCRQEIYDIMLDCWQDKPQRRPTFTDIRERLEAILGDVHPYLDLNVDHD
QEYYQGESTSDYDRVNSPRSSSIEAHSNNVEFVLWDSGTAIADLPKPRRLTTRRNTRIST
DTSGVEMSPTRVLLPTIGSRSDECDNEKWRSALDIRDSSSTDIPPPSPHRYYSLANINAG
LPKSPSSPQKVFAFTDDEVFAKKKPGAKKKTRRKKRSKQPRRTSQSRPDATDDSTVAKMV
IEIEVPDVGPPSIPEINITGSPNAPLLSPVGTSVSPCCSSCENKSPTRLPRPTGVCNIVT
ATSSEVIGSIYSFDNSRSTSGSGNIS
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atggcttttggtcagtcaagcttttggccatgtagagtagccgtttcgtcggtaccatct
cagctgtccactcctcgtctgatctgcaacgggagggatcccacatactgggatcccaca
tactgggagtacagcgggtacatcatcctgaagtggagcctgtccgtcacgcgagacctg
ccgcccgccaccaggagagccgtgtactacgtggtgcggcagcggagcaggtacctggag
aaccgcaggtggcacgtctctgattgggacgtcgtggggaaggcacatacaatggacggc
acggtgcatatcaggacactcacaccgggggccaactaccagttcgaagtgaccgcggtg
ctgcctgatggcaagaccggagcttctgtcttaggacaatggatcacccctcgaccagct
acagttcgtccaagagcaaatcctccatctgaccttagagtggaaaacaaacgctttaag
aacgggaacgtcagcgtcaccatagcctggactcccccggaagacctcccgtgtgagtac
agcctgcacttgctgacagacaccagcatagcagacacgcccgtccggattgataggccg
gtggagacgagatacacgtttcacaacctgacatttgacagcaattacacagtactgatg
cgcagtaccttctatgaaggtgctacggagagcagggctgtgagtatgtggttccaaacg
ccccactgtctggacgtctccggatacaacttcagtgtctgtgctcctggagccccgcgg
aacttgacctaccggctgtctgtgacggacaacgtcgcaatcgtctcgtggctgccgccc
ttcaggacttcacggaccaaccctgtgtccagttacgtggtgttagtgcggcaggaggtg
cagcctgccgtggacggcaccatactgtcagcacaagccacacaggaagtcattccaggg
gtaggacataccgttactactgtgcacgtgtgtgagattcagaagggactcggcagtctg
cggctagaggtcgggatggttgggagtaggttattactcattcggccctatgtcgggaaa
aaagaccccaccaccaccgtgctgaccagtcctaccatgattgcgggttccagccccatg
ccactgttcccggagtcgccagtgttccacgggttacgtcacgaccactgcttcctgttg
cagaacaggttctacagcgagacggacgtcctgtcagaccaacacgacgagtatgagatg
gacttcagccaactggagttggaagaggtcatcggagagggagcgtttggcaaggtgata
cgcggcaaggcgcgtggcctcccgaccatgccgaacacgccgatcgctacagtcgcagtc
aaaacactcaaagaaaatgcgactggtgttgaccaagcgaacctgctagcagagatcgag
ttgatgaagcagataggagcgaaccggaacatcgtgagtatcctgggctgctgcacccgc
cgctcgccagtgttcctggtggtggagtactgcccgttcggggatctcaagaacctcctc
agaaacatcagggaacagaaggagtatgaagagaacgaacatcccctgctgggtatcaaa
tgtcaggccatcaactctccaaatatgggcaacaacgaggaggcgtccttcgctccagtc
accgtctcctcgctggtccccatctacaaccccgcgagtgaagccaacccctccgctgcg
ggaggaaggccgaaggacgagaacctggacagcggaaccagcatggacctgagggatgtg
ctggacgtcctcccgaccgacctgctttcatttgcccggcagatttcaacaggaatggaa
taccttgcttcaaagaaattcgtccacagagatctggccgcgcgaaacgtcctggtgtgc
gaaaacaaagtggtgaagatctcggacttcggactcacgcgagatatctacgagaacagc
gagtaccggaagctaacagggggtaaacttccggtcagatggatgtcacctgaagccatc
tttgaccaagtatacaccacccagagtgacgtatggtccttcggagtggtcctgtgggag
attgtcactttaggtggatccccctacccgggactatcgggcaaggagctgttcagatac
ctgaaggcagggtaccgcatggagaaacccgagaactgcagacaggaaatctatgacatc
atgctggactgctggcaggataagccccagaggcgccccacattcacggacatccgggag
cgactggaggcgatcctcggggacgtccacccttacctggacctcaacgtggaccacgac
caggagtactaccaaggggaatccacctccgattatgacagagttaactctccgagatcg
tcctctatcgaagcccacagtaacaacgttgagttcgtcctatgggactcgggcacggcc
atagctgacctccccaaaccgagacgcctgaccactcgcaggaacactcgcatctccact
gacaccagcggcgttgagatgtctcccaccagagttctcctcccgaccatcgggtcaaga
agtgacgagtgcgacaacgagaaatggaggagcgctctggacatccgtgacagcagttcc
accgacatccccccgccatccccgcacaggtactacagcctagccaacatcaacgccggc
ctaccaaaatcaccgtcatcgcctcagaaagtatttgccttcactgacgacgaggtgttc
gccaaaaagaagcccggggccaagaagaagacgagaagaaagaagcgctccaagcagccg
aggcggacatcgcaatcaagaccagacgcaaccgacgattccacagttgccaagatggta
atcgagattgaagtcccggatgtaggaccacctagcattccagagataaacataacaggg
agcccgaacgcccctctcctgtcgcctgtggggacatcagtgtcgccttgctgcagttcc
tgtgagaataagagccccaccaggctgcccagacctacgggcgtgtgcaacatcgtcacc
gccaccagttcggaagtcatcgggagtatctactcgttcgacaactcacggagtacttcg
gggagcgggaatatatcatga

DBGET integrated database retrieval system