KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_89654Help
Entry
BRAFLDRAFT_89654  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K06584  
integrin alpha 8
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:bfo04512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1161 aa AA seqDB search
MDFLHKKMLPSTLKEYKRTFYAFVFALLLVNVHDSSCFNLDTSDATRVTRTGAAGSLFGF
SVDFHGQGDSAWLLAGAPKSQTAQPGVTEGGAVFRCDVTTSISLTPNPCAPIAFDTQGDD
RGVDLQGNILQKTQKSGQWFGATVKSASPAKDVVIACAPRYVYYTDTFNEREPVGNCFLA
AANFTQIRNYSPCKRALDSDWQSNIGWNQVSYCQAGFSADFSPTGPQDRNTHHCQCHTCP
HLCCMLLVVPTFMFFVVVFLFPIPDSQGGFGRLGYCQAGISLDFANDAEQLLLGAVGSYF
WQGQLFSKTLTYDNGVPNLGGDEKKTAEGDAWKDDFHMGYSTASGEFTGDNVPEYVVGVP
RGPGSPDHLKGHVAIYDSNLAVLQAMPEKTALIGEQMGSYFGYSLVVQDVNGDGLDDIIV
GAPMYSSPREHQWDLGRVYVYHLEQPGLSPVFSEPTILSGKVSSGRFGTSIAALGDINQD
GFNDIAVGAPYQTGEGDNMGAVYIYHGSAEGIREEPSQEIKASDFPEPLSAFGFSVAGAK
DVDNNRYPDVAIGAYEADSVVVLKSRPVVNADVTVQVEPEFIDTENKTCTLDDGTAVVCF
DINICASYTGINVPDEVELKYEVTLDALKTVGQRVFFSGRETSQTWSSTLRKADPDSMCL
TQKAFLRNDIRDKLSPITVAAAYSMADPVTPQPDQLLPILNMNQPSRRTRQVNILKDCGP
DNICVPDLKVFVSMQGTEIVVGSDKQLLMDVVVENAGEGAYEALLSVMLPEGVDFVGTGN
PRGGAIITCNLQEEDQRLLVCDLGNPFTARRTQLGLRLSTVQLTGDSNSLNFAFSVNSTN
AEEPGNEGDNHITFPVPVKVNASLSVRGVSLPEQVVFMKMERENEEITHERDIGPEVTHR
YEIRNVGPSDISSSKLKIQWPVHTRTGEDLLYLLAVNVTQGNGRCTVNGDVNPKGVSTES
ASAAQTAEALYALDSSRAARHRRAAATSDKEVAQMPVPQVNDLQVNDTEDCINAECIVID
CTLERLNKDNIAVVQIRSRLWVDTLLEGGFKETTLTSVADFEVLEFPYAITADVLPTARA
EIVTTANPSKPSVGKRPVPLWIIILSACAGLLLLVLIILVLFKCGFFKRQTMQEYTAIKR
NPPTSESPDASSGYISDKTDY
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggattttctacacaagaagatgttaccctcgacactgaaggaatacaagaggacgttt
tacgcgtttgtgttcgcgctgctgctagtcaatgtgcatgattcaagctgcttcaacctg
gatacctccgatgcgaccagggtcacaagaacgggcgccgccggtagcctcttcggcttc
tctgtggacttccacgggcaaggggacagtgcttggttgttggcgggagcccccaaaagt
cagacggcccagccgggcgtcacggaggggggtgcggtgttccgctgtgacgtcacgacc
agtatttccctcacccccaacccctgcgcacccatcgctttcgacacacaaggtgatgac
agaggagtggacttacaggggaacatcctacagaagacccagaagtcaggacagtggttc
ggagccaccgtcaagagcgcgtctcctgccaaggacgtagtcattgcatgtgcgccacgc
tatgtgtactacacagacacattcaacgagagggagcctgttggtaactgcttcctcgct
gctgcaaacttcactcaaatcaggaactattccccctgcaagcgggcgcttgactctgat
tggcagagtaatatcggttggaatcaagttagttactgccaggccgggtttagtgctgat
ttctcacccactggcccccaggatagaaacactcaccactgccagtgccacacgtgtcca
catctgtgttgcatgctgcttgttgtaccaacatttatgttctttgttgtggtttttttg
ttccccattccagacagccagggtggtttcggccgccttggctactgtcaggccggtatc
agtttggattttgctaatgatgctgaacagcttctgctgggtgctgtggggagctacttt
tggcaaggccaactgttttccaagacgctgacctacgacaatggcgtaccaaacttggga
ggagacgagaagaagacggcagaaggagatgcatggaaagacgacttccacatgggttac
tccactgcatctggagagttcacaggtgacaatgtgcccgagtatgttgtgggtgttccc
cgaggtccagggtctcccgaccacctcaaaggacatgtggccatctacgacagtaacctt
gctgtgctgcaggctatgcctgagaaaactgctctcatcggagaacagatgggatcctac
ttcggttactctctggtggtgcaagatgtcaacggagatggacttgatgacatcatcgta
ggtgcaccaatgtactccagccccagggaacaccagtgggatctgggaagggtctatgtc
taccacctggaacagcctggactctcgcctgtgttcagtgaacccacaattctgagtggg
aaggtctccagtggaaggttcggtacttccatcgctgctttgggtgacatcaaccaagat
ggcttcaacgacattgctgtgggtgccccttaccagaccggggagggagacaacatgggg
gccgtgtacatctaccacgggtcagccgagggcatccgggaggagccatcacaggagata
aaggcatcagacttcccagagcccctgtcagcgtttggcttctccgtggctggagctaag
gatgttgataacaacagatacccagatgtggctatcggtgcgtacgaggcggactctgtt
gtcgtactgaagtcccgcccagtcgtgaacgcggacgtgacggtccaggtggagccggag
tttatcgacaccgagaacaaaacctgcaccctggacgacgggactgccgtggtgtgtttt
gacatcaacatctgtgcttcctacactggcattaatgttcctgatgaagttgaacttaag
tacgaggtgaccctggatgcccttaagaccgtcggacagcgtgtgttcttcagcggccgg
gagacgtctcagacctggtcctccaccttaaggaaggcagacccagactccatgtgtctc
acacagaaggcctttctcaggaatgacatccgtgacaagctgagcccgatcaccgtggcg
gctgcgtacagcatggctgaccccgtgaccccgcagcccgatcagctcctgcccatcctg
aatatgaaccagcccagccggcgcacccgacaggtcaacatcctcaaggactgtgggccg
gacaacatctgtgtgcccgatctcaaggtcttcgtctccatgcaagggacggagatcgtt
gttggaagtgacaaacagctgctgatggacgttgtagtggagaatgctggggagggcgcg
tacgaagcactgctgtccgtcatgctgcctgagggggtcgactttgtgggaacaggaaat
cctcgagggggtgccatcatcacctgtaaccttcaggaggaggaccagaggctgctggtc
tgtgaccttggcaaccctttcacagcacgtcgcacacagctcgggcttcggctgtccact
gttcagctgaccggtgacagcaattcactgaactttgcgttcagtgtcaacagcacaaat
gcagaggaacctggaaatgagggagacaaccacatcaccttccctgtgcctgttaaggtt
aacgcgagcctttctgtcagaggagtgtccctgccagaacaggtggtgtttatgaagatg
gagagagagaatgaggaaatcactcacgagagggacatcgggccggaggtcacacacaga
tacgagatccgtaacgtgggtccaagtgacatcagcagctccaagctgaagatccagtgg
ccggtccacacccgcaccggggaggatctgctgtacctgctcgctgtcaacgtaacccag
ggcaacgggcgctgtaccgtcaacggggacgtcaacccgaaaggagtctctactgagtca
gcgtctgcagcacaaacagcggaggccctgtacgccctggactcctcccgtgctgccaga
catcgcagggcggcagcaacaagcgacaaggaagtggcacaaatgcctgtaccacaggtc
aatgacctacaggtcaatgacacagaggactgcatcaatgctgagtgtattgtgatcgac
tgtacgttagagaggctgaacaaggataacatcgcagtggtgcagattaggtccagactg
tgggtggacacactgctggagggtggattcaaagagacgacactaacatccgtggcagac
ttcgaggtgttggagttcccgtacgccattactgctgatgttctacctacagccagggca
gagattgtgacgacagctaaccccagtaagccgtctgtggggaagcggccggtgcccctg
tggatcatcatcctgtcagcctgtgccgggctgctgctgctggtgctcatcatacttgta
ctcttcaagtgtggtttcttcaagagacaaacgatgcaggagtacacggccatcaagaga
aacccccccaccagcgagagcccagacgcgagcagcggctacatcagcgacaagacggac
tactag

DBGET integrated database retrieval system