KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_90112Help
Entry
BRAFLDRAFT_90112  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Exosome [BR:bfo04147]
 Exosomal proteins
  Proteins found in most exosomes
   BRAFLDRAFT_90112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 205 aa AA seqDB search
MAIINKPLPHPGPLGAILKLQTTFGAKDLSESLSGRARENMASVESGSDAGTGIAAAYKD
KVKMNQLQNLLHDALISTEHVEHCCIIRRKDVSLRASSVGFTLYQDQIQMFVDAFKNPPQ
TREDGLYFEDRHYKCVRADKNAVYAKCVKRGLVVVRTGSLLIVGTYNDNMYPSVCVEAVE
KLGGQQGLVTPYYNLGLPQPHVPLA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcataaacaaaccacttccgcatccgggacctttgggcgccattttgaaactc
cagacgacgttcggcgcgaaagacctttcggagagtctgtcaggtagagcaagggaaaac
atggcatccgtggagagcggcagcgatgcaggaacggggatagcagcagcgtacaaggac
aaggtgaagatgaaccagttgcagaacctgctccatgatgctctgatctccaccgagcat
gtcgagcactgctgcatcatccgcaggaaggatgtgtcgctacgggcaagctctgtcggc
ttcacgctgtatcaggaccagatccagatgtttgtggacgcctttaagaaccctccccag
accagggaggacgggctgtacttcgaggacaggcactacaagtgtgtcagggccgacaag
aacgccgtgtatgctaaatgtgtgaagcgaggtctggttgtggtgcggacaggcagtctg
ctgatcgtggggacctacaacgacaacatgtacccaagtgtgtgtgtggaggctgtggaa
aaactagggggtcagcaggggttggtcacaccttattataacctggggctgccccagcca
catgtgccactggcttga

DBGET integrated database retrieval system