KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_90112Help
Entry
BRAFLDRAFT_90112  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K05759  profilin
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Membrane trafficking [BR:bfo04131]
 Others
  Actin-binding proteins
   Others
    BRAFLDRAFT_90112
Cytoskeleton proteins [BR:bfo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     BRAFLDRAFT_90112
Exosome [BR:bfo04147]
 Exosomal proteins
  Proteins found in most exosomes
   BRAFLDRAFT_90112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 7207649
NCBI-ProteinID: XP_002598863
JGI: 90112
UniProt: C3YXR6
AA seq 205 aa AA seqDB search
MAIINKPLPHPGPLGAILKLQTTFGAKDLSESLSGRARENMASVESGSDAGTGIAAAYKD
KVKMNQLQNLLHDALISTEHVEHCCIIRRKDVSLRASSVGFTLYQDQIQMFVDAFKNPPQ
TREDGLYFEDRHYKCVRADKNAVYAKCVKRGLVVVRTGSLLIVGTYNDNMYPSVCVEAVE
KLGGQQGLVTPYYNLGLPQPHVPLA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcataaacaaaccacttccgcatccgggacctttgggcgccattttgaaactc
cagacgacgttcggcgcgaaagacctttcggagagtctgtcaggtagagcaagggaaaac
atggcatccgtggagagcggcagcgatgcaggaacggggatagcagcagcgtacaaggac
aaggtgaagatgaaccagttgcagaacctgctccatgatgctctgatctccaccgagcat
gtcgagcactgctgcatcatccgcaggaaggatgtgtcgctacgggcaagctctgtcggc
ttcacgctgtatcaggaccagatccagatgtttgtggacgcctttaagaaccctccccag
accagggaggacgggctgtacttcgaggacaggcactacaagtgtgtcagggccgacaag
aacgccgtgtatgctaaatgtgtgaagcgaggtctggttgtggtgcggacaggcagtctg
ctgatcgtggggacctacaacgacaacatgtacccaagtgtgtgtgtggaggctgtggaa
aaactagggggtcagcaggggttggtcacaccttattataacctggggctgccccagcca
catgtgccactggcttga

DBGET integrated database retrieval system