KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_92621Help
Entry
BRAFLDRAFT_92621  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    BRAFLDRAFT_92621
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BRAFLDRAFT_92621
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     BRAFLDRAFT_92621
    3.1.1.84  cocaine esterase
     BRAFLDRAFT_92621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2148 aa AA seqDB search
MGQPHLVIGTLVVLFAFACGQFPPSGSEAQPQWPTSVQTEITLQAGTINGTFNSPEFPQN
YPDGLSIRWLIEASISKTIRLTFHAFELERTNILGECNFDYVAVYSRDRAGWDTLIGKFC
GQTLPSRSITSNTNAMSVVFVSDGSISRSGFNATFGTVRREQGLTGGTDNHQECIGVPEE
FYNYCKDLGYERTTATNFFDQSINGTLESPEWLNMKTVNTSCHPHLRLFICSLLMPRCLL
TVEFSSRGVQFVPKQQVPCQSLCEEVKSACPSAFANGTLQSTDCSGLNGTDCLNLDSPQD
CYYGKGQNYRGMSTLPEESDRVCLNWTSVLTGQLLYSYNWADPRENFCRNLGLENMQEPS
CLVNSGTAGSNELVTVEPCGLKPCGAIGCGVPPDVEFGTRNPVKNFHRPGEKVYINCNAG
YIRENDDMSITCTENGTWSKTDNLGCSVDYRIQLSNTLLATDRYLPQLPPSTGHVNISFE
AAVVEIIDADEKNEHMFGSMAFRLSWKDNRLSWTPSKYGNVTQLVLTTEDVWIPNIYLIR
NSDAKFSMFPAAPVTVTSDGEVGWDIVDLLTTTCDLEPALFPFDTMTCPVCLGTTTSVER
FNCPVEQGNEKPLESESYIEHFMKCGDQQKEVVDQWNAEWTVSVTGGSFGSGCIEVTFKR
IPTFHFCATLSPPIILSIIMCITFLLPTDKGDRISFGITILLSMVVSLVFITDVLPAKGS
MPVVAILLVLYMCMMGTFMLITVIVIKISTWEGNLPILIKKVFLRYVAKIVLLGDLTKQQ
RPAQKCVLEVNLDAEKTINDEEKKIGTISALADAVNTLAISGTSKTRKKDETKTDYQNLA
RVLDRMCIVLYIFSLVVSIPIIRFAADNTNIRWQIEASSDHCVHLTFDQFDVEKSEINPN
CTWDYVAVYDRDVINSGDVLIGKFCGNTPPDPFTSATKTLSVEFVSDATVRRTGFSATFH
AVTPCPGDGRDCYYGTGQNYKGMTTLPEEGGSTCLNWTSVLSSQLIAKYNWADPRENYCR
NFAIGNTEAPFCMVKTVANGKELIAMEPCGLRPCNAIGCGVPPDVTFGRRSPVKNFYMPG
ETVFISCNTGYILGTEETRITCTQNGTWSKTDISCSADYSLQLSHVLLDTERYLSQLPPS
TDHVNVTFEAAMVEIIDADEKNEYMFGSFAFRLRWKDNRLSWTPARYGDVTQLVLTTEDV
WIPNIYLMRNGDAKFSTFPAAPVTVTSEGEVEWDIIDLLTTTCDLEPALFPFDSMTCPVC
LGTTTSVERFNCPNPGDDRKLPELYIEHFMKCGDQGEEVVDQWNAKWTVTVEGGVFGQGC
ISVTFNRIPTFHSCTTLSPVIILSILMCITFILPIDKGDRLSFGITILLSMVVSLVFITD
VLPAKGSMPVVAILIVVYMCLMGIFLIATVIVIKISSREGDLPPLIKKVFLRYLARIVLL
GDMTKQHSLKFLQVDVEDFEMVHVARKKTSVSTQTSDAEIAKASKGANKSKSTPAEPKMQ
TEVLKRLQDTVRDLGNAVNNLTASKHSKTDDNEDSVKTDYEKMARVLDRIYRSLGKHLRH
AIIQIAQFFKMYCQNPTVTTTYGDVRGTTVTFTGPTAASSAIFTFKGVPYAAPPVGSLRF
RPPQPPSSWNDVLDAKSVGPKCPQVIRKPSDTVPNATIVDQLYGDGNATMDEDCLYLNIY
TPALSGNNLPVMFWIHGGGFMAGSSNAYRGMALSAHQDVVVVTINYRIGVLGFLPTPLAN
ATGNFGLLDQVLALEWVRDNIANFGGDPDKVTIFGQSAGGISVSLLVMSPPAEGLFRRAI
SESGAATTLPIISNDDAMFSITSSVGHSLNCTGDVDANMIDCIRSKSVESILAVPVVVYP
VVDHYFLPEDPMTLLQAGRFSKVDYLLGTNNDEARYGITISLFPDLDNGMTHEQQFLGTS
YMVDLAVPDIIAQNADKPGLINAILEEYSDPEMPDDPIAIRQQYFDSGTDYLFLAPTVSV
ANAQSAQPVNVYQYEFQHRPSILWFKPPYARADHHDEVMFVFGFPVDPVGPAAGLFTEEE
RNLSLDMMAYWANFARTGDPSDSAGAPTERPLVTWPRYTPDTPAYLQLRPEPAVGTALLK
PEKLKFWNEVVPRYLAGDTASPAARVWGSYVYLVLGVAICFGVFEIPF
NT seq 6447 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaccacatctcgtcatcggcactcttgtcgtcctctttgcatttgcgtgcggt
cagttcccgccatccggatcggaggcacaaccacaatggccgacaagcgtacagaccgag
atcactctgcaagccggcactattaatggaaccttcaacagcccggaatttcctcaaaac
tatccagacggtttaagcatccgttggctgatagaggcaagcatttcaaaaaccatacgg
ctgactttccatgccttcgaattagaaaggaccaacatcttgggtgaatgtaactttgac
tacgtggcggtatacagccgtgacagagcaggctgggacactcttatcggaaagttttgc
ggacagacgctacccagcagaagcatcacatccaacacgaatgcgatgtcggtagtgttt
gtgtctgatggctccatttctcggtcaggattcaatgcaacatttggtactgtgagacga
gaacaagggcttacaggaggaacggataatcaccaggaatgtatcggcgttcctgaggag
ttctacaactactgtaaagatctcgggtacgagagaacgacggcaacgaacttcttcgat
caaagcatcaacggcactttggagtcaccagagtggttgaacatgaagactgtcaacacg
tcttgccatccacatcttcggctgttcatctgctcgctgttgatgcctcgctgtctactt
acagtcgaattctcatcgaggggagttcaatttgttccaaaacagcaggtgccttgtcag
tcgttgtgcgaggaagtaaagtcggcgtgcccatcagccttcgccaatggaactcttcag
tccacggactgtagtggactgaatggtacagactgcctcaacttggattctcctcaagat
tgctactacggtaagggccagaactacaggggcatgtcgaccctacccgaggagagtgac
agggtgtgcttgaactggacgagtgttctgactggacagctgctgtacagttacaactgg
gcagacccgcgggaaaatttctgcaggaaccttggtctagaaaacatgcaagagccgtcc
tgtctggtaaactctggtacagcaggcagcaacgaacttgtcaccgtggaaccgtgtgga
ctcaagccatgtggagcaatcggatgtggcgtcccccctgacgtggagttcgggactagg
aatccggtgaagaacttccaccggcccggcgaaaaggtgtacatcaactgtaacgcaggc
tacatcagggagaatgacgacatgtccataacatgcacagagaacggcacatggagtaaa
acggacaaccttggatgttcggttgactacaggatacagttgtccaacacactactggcc
acagaccgctacctgcctcagcttcctcccagcacaggccatgtcaatatcagcttcgaa
gcagccgtggtcgaaataatcgacgcagatgagaaaaatgaacatatgttcgggtccatg
gccttccgtctgagctggaaagacaatcgcctgtcctggacaccttcgaagtatggcaat
gtcactcaactggtcctaaccacagaggacgtgtggattcctaacatctaccttataaga
aactcagatgcgaagttcagcatgttcccggctgcacctgtgacggtcacaagtgatgga
gaggtggggtgggacattgtcgatctcctgacgacaacctgtgaccttgaaccggcactg
tttccctttgacaccatgacttgcccagtatgcctcggaaccacaacaagtgtagaacgg
ttcaactgccctgtagagcagggcaacgagaagccactagagtcggagtcgtacatagaa
cacttcatgaaatgtggcgatcaacagaaggaagttgtggaccaatggaacgccgaatgg
acggtatctgtcacaggtggctcttttgggtccggctgtatcgaagtaacatttaagcgg
atcccgactttccatttctgcgccactctttctcctcccatcatcctctccatcatcatg
tgcatcacattcctacttccaacggacaagggagatcgtatttcatttggcatcacgatt
ctgctgtccatggttgtgtctctggtcttcatcactgatgtcttaccagccaaagggtcc
atgcctgttgtagcgatcctgcttgtcctgtacatgtgcatgatggggacattcatgctc
atcactgttatcgtcatcaagatcagcacttgggaaggaaatcttcccattcttatcaag
aaggtcttcctccggtacgtcgcgaagattgtcttactcggggatttgacgaagcaacaa
cgcccagctcaaaagtgtgtccttgaagtaaacttggatgctgagaagacgatcaacgat
gaagagaagaaaataggcaccatcagcgccctcgctgatgccgtgaacaccctcgcgatc
tcaggaacatccaagactcgtaagaaagacgaaacgaagacggactatcagaacttggcc
agggtcttagacaggatgtgtattgttctctatatattttccctcgtcgtctctattcct
atcatcaggtttgctgcagacaacacaaacatccgttggcaaattgaagccagttctgac
cactgcgtacatttgacgttcgaccagtttgacgtggaaaagtcggagatcaacccgaac
tgtacgtgggactacgtagctgtgtacgatcgtgatgtaataaacagcggagatgtccta
attggaaagttttgtgggaatacgccaccagaccctttcacgtcagcgaccaaaacgttg
tcggtagaattcgtgtccgatgccaccgttcgcaggaccggattctcggcaacgtttcat
gcagtgacgccatgtccaggagatggacgagactgttactacggcacgggccagaactac
aagggcatgacgaccctaccggaagagggcgggagtacgtgcttgaactggacaagcgtt
ctgtcttctcagctgatagccaagtacaactgggcagacccgcgtgaaaactactgtagg
aattttgcaataggaaacacagaagcgccattttgcatggtgaaaacagtagcaaatggc
aaagagctaatcgccatggaaccatgcggcttgagaccatgcaatgccattggatgcgga
gttccccctgacgtgacgtttgggcgcagaagtccggtgaagaacttctacatgcccgga
gaaacggtgttcatctcgtgtaacacgggctacatcctggggactgaggagaccaggata
acatgcacacagaatgggacgtggagtaaaacggacatcagctgttcagctgactacagt
ctgcagctgtcccatgtgttactggacacagaacggtacctatctcagcttcctccgagc
acggatcatgtgaatgtaacattcgaggcagccatggtcgaaataatagacgcagatgag
aaaaatgaatacatgttcggatcattcgccttccgtctgcgctggaaagacaaccgcctg
tcctggacacctgcgaggtatggtgatgttacccagctggtcctaaccacagaggatgta
tggattcctaacatctacctcatgagaaatggagatgctaagttcagcacgtttcccgcc
gctcctgtgacagtcaccagtgaaggggaggtggaatgggacatcattgatctacttaca
acaacctgcgacctcgagcctgcgctgtttccctttgactccatgacgtgcccggtgtgc
ctgggaacgacaacaagtgtagaacggtttaactgtccgaacccaggggacgacaggaag
ctaccagagttgtacatagaacacttcatgaaatgtggcgaccaaggggaggaagttgtg
gaccaatggaacgcgaaatggacggtaaccgttgaaggaggagtgtttggacagggttgc
atcagcgtgacctttaaccgcatcccaacattccactcctgtaccactctgtctcctgtg
atcatcctctccattctcatgtgcatcacattcattcttccaatagacaagggagatcgt
ctatcctttggcatcacgatattgctgtccatggtggtgtctttggtcttcatcacggat
gtgttaccagccaaagggtccatgcctgttgtagcgatcctgatcgtagtgtacatgtgt
ctgatggggatatttctgatcgccaccgttatagtcatcaagattagctcaagggaagga
gatcttccacccctcattaagaaagtcttcctccggtatctggccaggattgtgcttcta
ggtgatatgacgaagcaacattctttaaaattccttcaagtagacgtggaagattttgag
atggttcatgttgcaaggaaaaagacaagcgtttccactcaaacatctgatgcagaaatt
gctaaagcgtcgaagggtgcaaacaaaagtaaatcaactcctgcagaaccgaagatgcaa
acggaagtactaaagcgtttgcaggacaccgtccgtgacttgggtaacgctgtgaacaac
ctcactgcctctaaacactcaaagactgatgacaacgaagactcagtaaagacggactat
gagaagatggccagggtcctagaccggatctaccgcagtttgggcaaacacctccgccac
gcgatcatccaaatcgcacagttcttcaagatgtattgtcaaaatccgaccgtcactaca
acgtacggtgatgtgagaggcactacagtaacattcactggtccgactgccgcttcctcc
gccatctttaccttcaagggtgtgccctacgctgcgcctcctgtaggaagtctcagattt
cggccaccacagcccccttcctcgtggaatgatgtcttagatgctaaaagcgtcggcccg
aagtgtccacaagttataagaaaaccttctgataccgtaccgaacgcaacgatagtggac
cagctctatggcgatgggaatgccacaatggacgaggactgtctgtatctcaacatctac
acacccgctctgtctggaaacaacttgccggtgatgttctggatacatggaggtggcttt
atggcaggcagttccaatgcataccgcgggatggcgttgtcagcccaccaagatgtcgta
gtggtaaccattaactatcgtatcggagtgctgggatttctgccgacaccgcttgcaaat
gcaacaggaaacttcggattattggaccaggtactggctttagaatgggtccgtgacaac
atcgctaacttcggcggagatccggacaaggtgaccatatttgggcagtctgcggggggc
atcagtgtctcccttctcgtgatgtcccctccggcggaaggactgttccgtagagccatc
tcggagagcggcgcagccaccaccctccccattatctcaaacgatgacgccatgttcagc
attacgtcatctgttggccattccctgaactgcactggtgacgtcgacgctaatatgata
gactgtatacgaagcaagtccgtggagagcatcttggcagtacctgtggttgtgtaccca
gtggtagatcattacttcttaccagaagatcccatgactctactacaggccggacggttt
agcaaggtggactatcttttgggaacaaataatgatgaggcacgttatggcattactata
tcgctgttcccggatttagacaacggtatgactcacgaacaacagttcctggggacttct
tatatggtcgaccttgctgtgccggacatcattgcacagaacgccgacaagcctggttta
atcaacgcaatcctagaagagtacagtgacccggagatgcctgacgacccaatagcaatc
cgccaacagtattttgacagtgggactgattacctgtttttagcgcccacagtttccgtg
gccaacgctcaatcagcgcaacctgtgaatgtgtaccaatacgagttccagcaccgaccg
tccatactctggttcaagccgccgtacgctcgagctgaccaccatgacgaggtgatgttc
gtgttcgggtttccggtcgatcctgtcggacccgcggcggggctgttcaccgaggaggaa
cggaacctgagtctggacatgatggcgtactgggctaacttcgcaagaactggtgatccg
tccgactcagccggagcgcccaccgagcgccccctggtgacctggccgcgctacacaccc
gacacgcccgcctacctccagctgcgccccgagcccgccgtggggacggcgctgttgaag
ccggagaagctgaagttctggaacgaagtggtgccgaggtacctggcgggggataccgcg
agccctgccgcccgggtctggggaagctacgtgtaccttgtactgggcgttgccatatgc
ttcggcgtctttgagattccattttag

DBGET integrated database retrieval system