KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_92842Help
Entry
BRAFLDRAFT_92842  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    BRAFLDRAFT_92842
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     BRAFLDRAFT_92842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 480 aa AA seqDB search
MPSGSETVVLERNSQQEDVKVANGASSPIKAGQWGRAWEVNLFTYVGVLVLLSACPLLVL
YFYIACDKYQCSLTTPLLEVYYGEATLHDLWLKAPAMTAKAWKIGAIWLAWQIFLYVGLP
DVFHKIIPGYVGGVRPGARTPAGLVNDYNVNGLQAWAITHIVFFANAFYFHWFSPTIIFD
NWGGLLWFANAVGYAVSIFAFVKAHYFPTCAEDRKFSSNSVYDFMMGVEFNPRIGKWFDF
KLFFNGRPGIVAWTLINLSAAFKQYELYGHVTNSMILVNVLQAMYVTDYFWNEHWYLHTI
DICHDHFGWYLGWGDSVWLPWMYTLQGQYLVYNPVQLSTFHCLAMWMLGLGGYYIFRAVN
RQKDLFRRTDGNCLIWGKPPKYLQCSYISSDGKKHQSKLLLSGWWGLARHFNYTGDLMGC
LAYCMSCGFGHLLPYFYMVFMLILLIHRCLRDEERCRSKYGNQWDKYESLVPYRLIPGIF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcggcagtgagacagtggtcctggagaggaactcccaacaagaagatgtcaaa
gttgccaacggagccagtagtcccatcaaggctggacaatggggccgtgcatgggaagtc
aacttgttcacctatgttggtgtgctggtcctcttgtctgcctgccccctactcgttctg
tacttctacattgcctgtgacaagtaccaatgttccctgaccacccctctactggaggtg
tactatggagaggctaccctgcacgacctgtggttgaaggcaccagcaatgacagccaag
gcctggaagattggcgccatctggctggcgtggcagatttttctatatgttggtcttcct
gatgtcttccacaagataattcctggctatgtagggggcgtccgtcccggcgcacgtacc
ccggccggcctggtcaacgactacaacgtcaacggtctccaagcctgggcaataacccac
atagtattctttgccaacgccttttacttccattggttttctccaactattatatttgac
aactggggtggtcttctctggtttgcaaatgctgttgggtatgctgtatctatttttgcc
tttgtcaaagctcattacttcccaacttgtgcggaggacagaaaattcagcagcaactcc
gtctatgatttcatgatgggggttgaattcaaccctcgtatcgggaagtggttcgatttc
aaactgttcttcaacggccgtcctggtatcgttgcctggaccctgatcaacctctccgca
gcattcaagcagtacgagttatacggacatgtcaccaactccatgatcctggtgaatgtg
ctgcaagccatgtacgtcacggactacttctggaatgagcactggtacctgcacacgata
gacatctgccacgaccacttcggctggtacctgggctggggagacagcgtgtggctgcca
tggatgtacactctgcagggccagtatctggtgtacaaccccgtacagctatcaaccttc
cactgcctggccatgtggatgctcggcctcggcggctactacatcttccgcgcagtcaac
cggcagaaggacctgttccgccgcacggacggaaactgcctcatctgggggaagcctccg
aagtacctgcagtgttcctacatctcctccgatgggaagaagcaccagagcaagctgctg
ctgtctggctggtggggcctggcacgacacttcaactacacgggggacctgatgggctgc
ctggcctactgcatgtcctgcgggttcggccatcttctgccgtacttctacatggtcttc
atgctcatcctcctcatccatcgctgtctccgtgatgaggagcgatgtcgctccaagtat
gggaatcagtgggacaagtatgagtccctcgtgccatataggctgatccctggcatcttc
taa

DBGET integrated database retrieval system