KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_92996Help
Entry
BRAFLDRAFT_92996  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    BRAFLDRAFT_92996
Protein phosphatases and associated proteins [BR:bfo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     BRAFLDRAFT_92996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 169 aa AA seqDB search
MGNESSLPEMCTHFDPEEIRRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDI
FDQDGNGEVDFKEFIEGMSQFSMKGDKNTKLRFAFKIYDMDKDGYISNGELFQVLKMMVG
SNLKDTQLQQIVDKTIINADKDGDGKISFEEFCEVVGSMDIHKKMVVEV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgaatcgtcccttccagaaatgtgcacacattttgacccggaggaaatccgc
aggttagggaagcggtttaagaagctggacctggacaactcagggtccctgtcggtggag
gagttcatgtcgttaccagagctgcagcagaacccactggtccaacgggttattgacatt
ttcgaccaagacggcaatggagaggtggactttaaagaattcatagaaggaatgtcgcag
ttcagtatgaagggagataagaacaccaagctaagatttgcctttaagatttatgacatg
gacaaagacggctacatctccaacggggagctgttccaggtgctgaagatgatggtgggc
agcaacctgaaggacacacagctgcagcagatcgtcgacaaaaccatcatcaatgcagac
aaggacggcgacgggaagatttcttttgaagaattttgtgaagttgttggaagtatggat
atccacaagaagatggtggtggaggtgtaa

DBGET integrated database retrieval system