KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_94318Help
Entry
BRAFLDRAFT_94318  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bfo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bfo00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 227 aa AA seqDB search
MAMMNNYHHSKMDGSWVYANITGPGPGHNTISTSTQHVRNFFDLSGQALSGAGAGDIIHF
SRYTGKVVLVTNVASACYLTTREFTQLNNLMHLYGLHGLVILAFCCNQFGHSEPFENDEI
VKCLRYVRPGPPFQPSFQLFVKCDVNGSRTHRVFDFLKDRLPYPSDDNTMLVAESSEITW
NPVKRNDITYNFEKFLIGRDGQPYRRYSYKTPPSRLHQDIKRLLGIE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgatgaacaattaccaccactcaaagatggacggatcctgggtgtatgctaac
atcacgggccctggtccgggccacaacaccatcagcacatcgacccagcacgtccgcaat
ttcttcgacctgtctggccaggccctgagcggggctggtgccggggacatcatccacttc
tctcgctacacgggcaaggtcgtcctggtaaccaacgtggcgtcagcctgctacctcaca
acacgggagttcactcagctaaacaacctgatgcatctgtacggcctacacggcctggtc
atcttagcgttctgctgtaatcaattcggacacagcgagccgtttgagaatgacgagatt
gtgaagtgtctgagatacgtccggcccggaccgccatttcagcccagtttccaattgttc
gtgaagtgcgatgtgaacgggtcccggacccaccgcgtgttcgacttcctgaaagacaga
ctaccctaccccagcgatgataacactatgctggtcgctgagtcgtcagaaatcacatgg
aacccagtcaaacgtaacgatatcacgtacaactttgagaagttcctgattggtcgagac
ggacagccgtaccgccgttacagttacaagactcccccctccaggctgcaccaggacatc
aagagactcctgggaatagagtaa

DBGET integrated database retrieval system