KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_94853Help
Entry
BRAFLDRAFT_94853  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00510  N-Glycan biosynthesis
bfo00514  Other types of O-glycan biosynthesis
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    BRAFLDRAFT_94853
   00514 Other types of O-glycan biosynthesis
    BRAFLDRAFT_94853
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     BRAFLDRAFT_94853
Glycosyltransferases [BR:bfo01003]
 Terminal extension
  Sialyltransferase
   BRAFLDRAFT_94853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 DUF1866
Motif
Other DBs
NCBI-GeneID: 7247902
NCBI-ProteinID: XP_002604691
JGI: 94853
UniProt: C3YGI1
AA seq 351 aa AA seqDB search
MWSKRARLVFFYLCVILVLTFIFVHFLFNGNRFQVTFRHKKVAIAVTRAKYMPLSKHDLL
CELKNRVWFKTLPSTEGPFKALNYSLLEPKNTLYQLHHDGFKTCAAVMNSAAILGSNLGE
EIDSHDAVMRFNNAPLSEEYRADIGVKTTLRLMNSQLLADPSFNFFTDPIYRNITMIVWD
PAAYTGDMEEWYQNPDANFFSSYEQRRRMFPRENLYITDPRFYWELWDVLQENTEAMIHP
NPPSSGFQGIAVMLSLCDQLDVYEFVPSERISMKCHYYEKWKLNPACTLGWWHDLRAEKY
FILRMNQGTKDDITKKGKVTLSGYRANDCKATSHAPALTSLNRGLQLPSRN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtggagtaagagagcaagattggtcttcttctacctctgcgtcatactagtcttgacc
ttcatcttcgtccactttctgttcaatggaaatcgcttccaagtcaccttccgtcacaag
aaagttgctattgctgtgactcgtgccaagtacatgcccttgtctaaacatgaccttctc
tgtgaacttaagaacagggtgtggtttaagacactcccaagtacagaaggcccatttaag
gccctgaactactccctattggaaccaaagaacaccttgtaccagttgcaccatgacggc
ttcaagacatgtgctgcagtgatgaactctgcagctattctaggatcaaatctaggagag
gaaatagattctcatgatgcagtgatgaggttcaacaacgcaccactgtcggaggaatac
agggcggatattggtgtgaaaaccaccctgcgcctgatgaactcacagctcctcgccgac
ccgagttttaacttcttcacagatcctatctacaggaacatcaccatgattgtgtgggac
cctgcagcttacactggggacatggaagagtggtaccagaatcctgatgccaacttcttc
agctcatatgagcagcggaggaggatgttccccagggagaacctgtatattacagatcct
cgcttctactgggagctgtgggacgtcctacaggagaacactgaggccatgatccatccc
aacccaccctcctcaggcttccaaggtattgcggttatgctgtccctgtgcgaccagttg
gacgtgtacgagtttgtcccatcggagcggatctccatgaaatgtcactactacgagaag
tggaagctgaacccagcctgtaccctgggctggtggcacgaccttcgcgcagagaaatac
ttcatcctccgcatgaaccagggtaccaaggacgacatcaccaaaaagggaaaagtgact
ctaagtggatatcgtgctaatgactgtaaagctacgtcacatgcacctgcacttacttct
ctcaacagaggacttcaactaccttcaaggaattag

DBGET integrated database retrieval system