KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_95034Help
Entry
BRAFLDRAFT_95034  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BRAFLDRAFT_95034
Peptidases [BR:bfo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BRAFLDRAFT_95034
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_95034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 721 aa AA seqDB search
MSALETLYGYLPCVKVPRGGEKIYKDECIYCYDTPESEGGLFVCLKSYMGLCHLHVQKFY
EKFPENPIYLHLKRTKLEISGAAGGGEAEDPPAKKPTRLAIGVEGGFDVSEEGRYEIQEE
IAIVVMPGYESFPYPSIEDTPVQIQLAIEGILKSSGADKQSAVEAWDGEVRQVSKHADKL
EQLNNGVKVPPKGWKCSRCDLVENLWMNLTDGSISCGRRYFDGSGGNNHAVDHFRETGFP
LAVKLGTITPTGADVYSYDEDDMVEDPHLARHLAHFGINMMSMEKTDKTMTELEIDINQR
VGEWATIQESDKQLKPMYGPGYTGMKNMGNSCYLNSVMQVIFTLPDFRKRYFEDYDLILN
RAPEEAPSDFTTQMAKVGYGLLSGTFSNPPEEEMAAAAAAPPAKKVQAEERIQCVQSGKV
RYKQRSDYLLSLPVPVELADNREELVVYETRKREKESKGEKMDPKELVRAKLSLQTCLDS
WAEPESIQDFYSSALQARSVANKSTRFATFPNYLMVHLKKFTIGEDWVPKKLDVSMSIPD
ELDLEHLRGKGIQQGEEELPEGEEPPMGEPAEAEPEIDEETVIQLSEMGFPTEACRKAVY
YTSNCGAEAAMDWIMQHMDDPGLSEEALTILEAMGFTRGQAIRGLKATDNNLERAADWLF
SHSDELDTMPMDTAEQESLPVQATPQVQDGTGKYKLVAFISHMGTSTMCGHYVCHILKDG
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgttagaaactctgtacggctatctcccctgcgtcaaagttccccggggtggg
gagaagatatacaaggatgaatgcatatactgctacgacacaccggagtcggagggtggt
ctgtttgtgtgcctgaagtcgtacatgggcctgtgtcacctgcatgtacagaaattctac
gagaagttcccagagaaccccatctacctgcacctgaagaggaccaaactagagatctct
ggtgcagcagggggtggggaagctgaggaccctccagccaagaaaccaacaaggctggcc
attggtgttgaaggaggttttgatgtgagtgaagaaggtcgctatgagatccaggaagag
atagccatcgtggtgatgcctggatacgagtccttcccatacccaagtatagaggacaca
cctgtgcagatccagttggcgatagaaggtatcctgaagtcctcaggtgctgacaagcag
tctgcagtggaggcctgggatggggaagtcagacaagttagcaaacatgcagataagcta
gagcagctgaataatggagtcaaggtgcctcccaaaggctggaagtgttctaggtgtgac
ctagtagaaaacctgtggatgaacttgacagatggaagcatctcctgtggacggaggtac
tttgatgggtcgggagggaacaaccatgccgtagaccacttcagagagacaggatttcct
ctggctgtcaagctggggaccatcacgcctaccggagcagatgtttactcctacgatgag
gatgacatggtggaagaccctcacctggccagacacctggcacactttggtatcaacatg
atgagcatggagaagaccgacaagacaatgacggagcttgaaatcgacattaaccagagg
gtgggggaatgggcgaccatccaggagtcggacaaacagttgaagcccatgtacggtcca
gggtacaccgggatgaagaacatgggaaacagctgttatctcaactccgtcatgcaggtc
atcttcacactaccagacttccggaaaagatattttgaagactatgatttaatcttaaac
agagcacccgaagaggcccccagtgactttactacccaaatggcaaaagttgggtatggt
ttgctatctggcaccttctccaacccacctgaagaggagatggctgcagctgcagctgca
ccacctgcgaaaaaagtccaggcagaagaacgtatccagtgtgtccagtcaggcaaggtt
aggtacaagcagcgctcagactaccttctgtccctacctgttcctgttgagctggcagat
aacagggaggagctagttgtgtacgaaacaaggaagcgagaaaaggaaagcaaaggggag
aaaatggaccctaaggagttggtgagagctaagctgtccctgcagacatgtttggatagc
tgggcagagcctgagtctatccaggacttctacagcagtgctctacaggccagatctgtg
gccaacaagtcaacaagatttgccaccttccccaactatttaatggtgcatctgaagaag
ttcacaataggtgaagattgggtgcccaagaagttagatgtgtccatgagcatccctgat
gagctggacctggaacacttgagagggaaggggatacagcagggggaggaagagcttcca
gagggggaagagccaccaatgggagagcctgctgaagctgaaccagagattgatgaagaa
acagtgatccagctgtcggagatggggttccctacagaggcctgcaggaaggctgtgtac
tacacctccaactgtggggctgaggcagccatggactggatcatgcagcatatggatgat
cctggcctgagtgaagaggccttgaccattctggaggccatgggcttcacaaggggacag
gccatccgggggctgaaggctacagataacaatttggagagagcagcagactggttgttc
agccactctgatgagctggacaccatgcccatggacacagcagaacaggaaagtctcccc
gtacaagcaactccacaagtccaggatgggactggaaagtacaaacttgtagccttcatc
agccacatgggaacctctacaatgtgtggccactatgtctgccatatcctcaaggatgga
aggtga

DBGET integrated database retrieval system