KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_95716Help
Entry
BRAFLDRAFT_95716  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1056 aa AA seqDB search
MENAEQITFPASDNQPTTEGFDSTTEASSISPSVPENIPRHPTIPPAAEGIVDVVTPNQT
KDDSSPEDKNSEQGKGTGSGKKKGRGSKKKNVTPTGVGRGNTQSLQEAKKKGRKARKAEK
ELDLLDLSGLSLEERPVPKGTGVVFDERMADYHCLWEDLSDCKAERPARFTETLTLLRQR
GLLDRCVTIPSRPATREEVLSIHSEGLLGKLESSVTMTTDQLRQLSETFEDIAIHPKSLE
CARLSAGCTLQLMDQVLTGNVRNGMAVVRPPGHHADRDQSCGYCLFNNIAIAARQALTKY
SLERVLIVDWDVHFGNGTQDLFYDDPRVLFFSIHRYEHMEYWPHMERANYSFVGRGAGKG
YNVNVPWNKIGLGDPDYMAAFQQVLMPMAYEFDPQLVLVSAGFDSAVGDRMGKMVLMPMA
YEFDPQLVLVSAGFDSAAGDPKGEMDTTPSAYAHLLHMLKGTCTSGREVGLVHDEAMMNH
VNIWMPGHPEQPYRIRRIMQALDRHRLQDRCVKLESRLATEEELLYLHTAEHLQLMQETA
EMTPRQLNRTQADFNSIFLCNDTYKSACLAAGCSMNAVEAVATGSVRSAVAVVRPPGHHA
EVDKPCGFCIFNSAALAARFAQKRLGVGRVLILDWDIHHGNGTQHMFVDDPTVLYISIHR
YDNGMFFPGSPDADCTVVGSGPGEGFTVNVPWSRGGMGDPEYMAAFQQVVMPIAYEYSPE
LVIISAGFDAARGDPLGHCDVTPPGYAHMTHMLSSLAGGRVVLLLEGGYNLSSISESMSE
CTKILLGDPCPPLEYSPPCEEAVQSMLSTLHVHQKYWRSLAFQVDVGTKDVCSDEGGDES
STTGTEREPDRYDNGMFFPGSPDADCTVVGSGPGEGFTVNVPWSRGGMGDPEYMAAFQQV
VMPIAYEYSPELVIISAGFDAARGDPLGHCDVTPPGYAHMTHMLSSLAGGRVVLLLEGGY
NLSSISESMAECTKILLGDPCPPLEYSPPCEEPALMDLNLQMGQLSITGEEKDNQNTAGE
IEEKTPTKGTGSDVAAPPVQHHLQLQPPGLWYFKTV
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgcagaacaaatcacatttccagcatcggacaatcaaccaaccacagaaggc
tttgacagcacaacagaagcaagcagtatttctccgtctgtccctgaaaacattcctcgc
catcccacaattccacctgcagctgaaggtattgttgatgtcgtcacaccaaaccagacg
aaagatgacagttcaccagaggacaagaatagcgagcagggtaaggggacaggatcaggc
aagaaaaaaggaagaggttccaaaaagaagaatgtcactcccaccggggtggggagggga
aacactcagtcacttcaagaagcaaagaagaagggaagaaaagcaagaaaggctgaaaaa
gagctggacctcctagatttgagtggactgagcctggaggaaaggcctgtacccaaaggg
acgggggtggtgtttgatgagagaatggcagattaccactgtctgtgggaggacctgagc
gactgtaaggcagaacggccagcaaggttcactgagacgctgacattactgcgacagaga
ggcttgctggacagatgtgtcaccatcccctcccgccctgccactagagaagaggtcctc
agtattcactctgagggtctcctggggaaactggagagcagtgttaccatgacaacagac
cagctaagacagctctcagagacttttgaagacatagccatccaccccaagtctcttgaa
tgtgctcgtctgtctgctggttgcaccctccaacttatggaccaagtcctcaccgggaac
gtacgcaacggaatggccgtcgtacgccctcccggtcatcacgccgaccgagaccaatcc
tgtggctactgcctcttcaacaacatcgccatcgcagccagacaagcgttgacaaagtac
agtttggaaagggtgctgatagtcgactgggatgtccactttgggaacggaacccaagac
cttttctacgatgatccgagggtcctcttcttctccatccaccgatacgagcacatggag
tactggccacacatggagagagccaactacagctttgtcgggaggggggctggaaaaggc
tataacgtgaatgtgccatggaataagatagggctgggagacccagactatatggctgca
tttcaacaggttcttatgccgatggcgtatgagtttgatccgcagcttgtgttggtttct
gctgggtttgactcagcagtgggagaccgtatgggaaagatggtcctcatgcccatggcg
tatgagtttgacccccagttggttctggtatcagctggttttgactcagctgccggggat
cccaagggagaaatggacacgaccccatcagcttatgcacacctcctacacatgctgaaa
ggtacctgtacatcaggacgtgaggtggggctggtacatgatgaggccatgatgaaccat
gtcaacatctggatgcccggccacccggaacaaccgtacaggatccgcaggatcatgcag
gcactggacaggcacaggctgcaggacaggtgtgttaagttagagtcgagactggctaca
gaagaggagctgttgtacctgcacacagctgaacacctgcagctgatgcaggagacagca
gagatgacaccccgacagctgaacagaacacaggcagacttcaactccatcttcctatgt
aacgacacatacaagagtgcctgtctagcggcagggtgttccatgaacgccgtggaggcg
gtcgccaccgggagcgtacgtagtgccgttgctgtcgtccgtccgccgggtcatcatgca
gaggtggacaaaccctgcggcttctgtatcttcaacagtgccgccctggcagctcgcttc
gctcagaagagactgggggtagggagggtactgatactggactgggatattcaccatggt
aacggtacacaacacatgtttgtggacgacccaacagtgctctacatatctatacacagg
tatgacaacggcatgtttttccctgggagccccgatgctgactgtaccgtggtggggagc
ggaccgggggaggggtttactgtcaacgtgccatggagtaggggaggcatgggggatcct
gagtacatggctgcatttcaacaggttgtgatgcccatagcgtacgagtattcccccgag
cttgtcatcatctcagcaggatttgatgcggcgaggggggaccccctaggccactgtgat
gtcacccccccaggctatgcccacatgacccacatgctgagcagcctggcaggggggcgg
gtcgtactactgctggagggggggtacaacctgtcatccatctccgagtccatgtcagaa
tgtaccaaaatcctcctgggggacccctgccctccattagagtactcccctccatgtgaa
gaggcagtacagtccatgttgagcacccttcatgttcatcagaagtactggagaagtctg
gctttccaagttgatgttgggaccaaagatgtctgcagtgatgagggaggcgatgagagt
agtaccacaggaacagagagagaaccagacaggtatgacaacggcatgtttttccctggg
agccccgatgctgactgtaccgtggtggggagcggaccgggggaggggtttactgtcaac
gtgccatggagtaggggaggcatgggggaccctgagtacatggctgcgtttcaacaggtt
gtgatgcccatagcatacgagtattcccccgagcttgtcatcatctcagccggatttgat
gcggcgaggggggaccccctgggccactgtgacgtcacccccccaggctatgcccacatg
acccacatgctgagcagcctggcaggggggcgggtcgtactactgctggagggggggtac
aacctgtcatccatctccgagtccatggcagaatgtaccaaaatcctcctgggggacccc
tgccctccattagagtactcccctccatgtgaagaaccagcattgatggacctcaatctt
cagatgggacaactcagcattacaggggaggaaaaggacaatcagaatactgcaggggag
atagaagagaagacaccaacgaaagggactggaagtgatgtagcagcgccacctgtccaa
catcatttgcaactgcagcccccaggtttgtggtactttaaaacagtttga

DBGET integrated database retrieval system