KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_95861Help
Entry
BRAFLDRAFT_95861  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     BRAFLDRAFT_95861
Peptidases [BR:bfo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BRAFLDRAFT_95861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1291 aa AA seqDB search
MTFALHMLEKEVGDQKVNTMPAIVRDFGDSLFDQPMDLMDYMPAAVLDSPTPAQGTGPED
GHAGETRDVEWEQGACGLHNLGNTCFMNAGLQCLLSNAQLCSFILDAPTGSPAGIPAGSI
FPAGIPAGKTFSCRNSCRNFLQDKGSIKQLCIEISQCFGKVPVGLANNLLIGEHALTITD
LLSTRITMCIITKKRKHDGQEFLALLLDSLHEELNKSHKLVQKHRVLPDQPLAAPGDQEC
AIYEDNSEESKSSVTSMDVPSPTSNLLVLEGSPSFHTEQSPARNLPNFEEYLMKDTKTLN
TNLQTTYTLNNEKSVKSPPRVQSLCHRKVHNTAEESVKLNNKDTNVMAEKQGHCVTQGAC
CGELQVKGQNINNKRLKVDCALSLKCGPSEDEQKRRATDFISNISNNQLALPGCQGTKCK
VTSNFMSKNELNPTREVLNRMGVAMEGVKGEEAVEGVKGGEAGEDVSKLEMEECSGESEA
DLEWEMYVRDNQSVVVDTFQGQFKMVTWVPCDHSTPVRYCLTVQDYGKVLDLKMALQVVL
GGPQDQEMVVLAEVFDHHISRTLAVEGVKGGEAGEDVSKLEMEECSGESEADLEWEMYVR
DNQSVVVDTFQGQFKSTVTCSVCHHPSVTYEPFMYLSVPLPRATDRQIVVTWVPCDHSTP
VRYCLTVQDYGKVLDLKMALQVVLGGPQDQDMVVLAEVFDHHISRTLDDGTLLRYVNATN
REICGFEVTQVRPADHQATNTSSTCTLGAGYTGGSQDHSMADSQDQAWGSLKLVSTWRSC
AVCLEEMADNQLLTHDPGCGCCLCDTCMELTSKHYLNSGFQCPMRLFGYPRVLYAPSEVT
GPDMYSSVQQFLPLGTSYSLHLTNGQGVHCSRCMFTVHCSGCEVPREGPTSLKPGDHLTV
RLTGRCDQDQDSVQDHCSMKDFSSTPHVLTLEESFKAFTESEELDEHNPWYCSQCRQNQS
ARKTLKVCRFPETLVVYLKRFVFHQLTGIKIDSKVHYPLETLDVSALQDDSCTSCPPTYD
LQSCILHFGGVNAGHYTCFTKHPLSSSWRYYNDETVSQLQPSEEDAKNVYVLFYQRKGTS
VSFRPPSPLPVDHFPTPSPPQSPCLTNLGSPNIMEDINDMLRDYSSTQGDPQDDGSPFFG
AVNMADREGVNAGHYTCFTKHPLSSSWRYYNDETVSQLQPSEEDAKNVYVLFYQRKGTSV
SFRPPSPLPVDHFPTPSPPQSPCLTNLGSPNIMEDINDMLRDYSSTQGDPQEDGSPFFGA
VNMADREGLYNNQATESPFPDQQEEMLKFDL
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttgccctgcacatgcttgagaaggaggtcggggaccagaaagtgaacaccatg
cctgccattgtgagggactttggagacagtctgtttgaccagcccatggacctgatggac
tacatgcctgctgcagtactggacagtcccaccccagcccagggcactggacctgaggat
ggacatgcaggagaaacaagggatgtggagtgggaacaaggtgcatgtggtctgcacaac
ctggggaatacctgcttcatgaatgcaggtctacagtgtctgctcagcaatgcacagctc
tgtagcttcatcctggatgcaccaacaggaagtcctgcaggaattcctgcaggaagcatt
tttcctgcaggaattcctgcaggaaaaactttttcctgcaggaattcctgcagaaatttc
ctgcaggacaaaggctctataaagcagttgtgtatagaaatttcacagtgttttgggaag
gtccctgtgggacttgctaataacttgctaattggggagcatgccttgacaataactgac
ctcctttcaacccgcataacaatgtgcataattaccaaaaagaggaagcacgatgggcag
gagtttcttgctctgcttctggatagtcttcatgaggagctgaacaagagtcacaaactt
gtacagaagcatcgagtcctgccagaccagcccctggctgcccccggtgaccaggaatgt
gccatatatgaagacaacagtgaggaatctaagagcagtgtaaccagtatggacgtaccc
tcccccacttccaacctgctggtgttagagggaagtccctcatttcacacagaacaaagt
cccgcccgaaatcttcccaactttgaggaatacctgatgaaggatactaaaactctgaac
acaaacttgcagacgacgtacacgttgaataatgagaagtctgtcaagtctccgcccaga
gtgcagagcctgtgtcatagaaaggtccacaataccgcagaagagagcgtgaaacttaac
aacaaggacacaaatgtgatggcagagaaacagggacactgcgttacacagggtgcatgc
tgcggagagctgcaggtgaaaggacagaatatcaacaacaagagactgaaagtagactgt
gctttatccttaaagtgtgggccaagtgaggatgagcagaagagaagagccacagatttc
atcagtaacatcagcaataaccagctggcactgccgggatgtcagggcaccaagtgcaag
gtcaccagtaacttcatgtccaaaaatgaactgaaccccacccgggaagtgctgaacagg
atgggcgtggccatggagggtgtgaaaggggaagaggctgttgagggtgtgaaaggggga
gaagctggggaggatgtgtcgaagttagaaatggaggagtgttcaggggagagtgaggcc
gacctggagtgggagatgtatgtgagagataaccagtctgtagtggtggacacattccag
ggccagttcaaaatggtgacctgggtaccgtgtgatcactccaccccagttcgctattgt
ctgacagtccaggactatggcaaggtccttgacctgaagatggccctgcaagttgtcctt
ggtggaccacaggaccaggagatggttgttctggctgaagtgtttgaccatcacatctcc
aggacactggctgttgagggtgtgaaagggggagaagctggggaggatgtgtcgaagtta
gaaatggaggagtgttcaggggagagtgaagccgacctggagtgggagatgtatgtgaga
gacaaccagtctgtagtggtggacacattccagggccagttcaaaagtacagtgacctgc
tctgtatgtcaccacccttctgtgacttatgaaccattcatgtacctgtctgtacctctg
cccagggccactgacagacaaatagtggtgacctgggtaccctgtgatcactccacccca
gtccgctattgtctgacagtccaggactatggcaaggtccttgacctgaagatggccctg
caagttgtccttggtggaccacaggaccaggacatggttgttctggctgaagtgtttgac
catcacatctccaggacactggatgacggtacattgctgagatatgtcaacgcaaccaac
agggagatctgtgggtttgaggtgacccaggtccgacctgctgaccaccaggccaccaac
accagcagtacatgtaccctgggtgccgggtacacaggtggttcacaggaccacagtatg
gcggacagccaggaccaggcctggggcagtctgaagctggtcagcacctggcgcagctgt
gctgtttgtctggaggagatggcggacaaccagctgttaactcacgaccccggctgcggc
tgctgcctgtgtgacacctgcatggagctaacatccaagcattacctgaacagtggattt
cagtgcccgatgaggttgtttgggtatccccgagtgctgtatgcacccagtgaggtgact
ggacctgacatgtacagctcagtacaacagtttctgcccctgggcacctcctattctcta
catctcaccaatggacagggagtccactgctctcgctgtatgttcactgtccactgtagt
gggtgtgaggtccccagggaaggtcccaccagtctgaagcctggtgaccacctgaccgtc
aggctgaccgggcggtgtgaccaggaccaggacagtgtccaggaccactgctccatgaag
gacttcagcagcaccccacatgtgctcaccttggaagaaagtttcaaggcctttactgaa
agtgaggagctggatgaacacaacccctggtactgctcgcagtgtcggcagaaccagtct
gcaaggaaaacactgaaggtgtgccgcttcccagaaacccttgtggtgtacctgaagaga
tttgtgtttcatcaactcactgggatcaagattgacagtaaagtacactacccactggaa
actctggatgtttcagccttacaagatgactcctgtaccagctgtcctcccacatatgac
ttacagagctgcatccttcattttggaggagtgaatgctgggcactacacctgcttcact
aagcacccgctcagctccagttggagatactacaacgatgagacagtgtctcagctacag
ccttcagaagaagatgccaaaaacgtttacgtactcttctatcagagaaagggaacgtcc
gtgagctttagacccccatctcctctaccagtggaccacttcccaacaccctcccctcct
cagagcccctgtcttaccaacctgggcagccccaacattatggaagacatcaacgacatg
ctcagggactacagctccacacagggggacccccaggatgacgggtctccgttctttggt
gcagtcaatatggcagacagggaaggagtgaatgctgggcactacacctgcttcactaag
cacccgctcagctccagttggagatactacaacgatgagacagtgtctcagctacagcct
tcagaagaagatgccaaaaacgtttacgtactcttctatcagagaaagggaacgtccgtg
agctttagacccccttctcccctaccagtggaccacttcccaacaccctcccctcctcag
agcccctgtcttaccaacctgggcagccccaacattatggaagacatcaacgacatgctc
agggactacagctccacacagggagacccacaggaggacgggtctccgttctttggtgca
gtcaacatggcagacagggaaggtctgtataacaaccaggccacagaaagtcctttccct
gaccaacaagaagagatgctgaaatttgatctgtaa

DBGET integrated database retrieval system