KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_97935Help
Entry
BRAFLDRAFT_97935  CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 650 aa AA seqDB search
MEGSNGSNVTVANQATGISLHPQVVPLNHETCSVDIIDWSDDNRIAVATKKGVYCLNFLS
SADLVDENFRMQRTFLELSTKKAVSGTNLSQEYMHGQVIALENGYRAVRWSPLECGADGR
CLLMTLTLDHSLAVHFSQQSQLHWQEILDFSELESSHKETAKSGKRSPKLFATDMQWSET
FCKACDTGDGFELDRHVMLAVATNSGQVVLWEFKCPIVDRTSAVGRQLIETTSECITCLA
WVQEQNNPPGGIAFGHLDGTISIWPTGVDTGSTTFLTTPTVLWKEKDLLAVTSVKSRPLE
KNGSILVASKGPNVMCFEIEKSGDNITLLHTVWTDAIHSMPILGLALSTEHKIYTCCMGS
AITVTNIKRNKSGLSLEAFPIDTNSSLLKRGYGVALSRNSVFLGCVSGLTDTLNGVVKLQ
VNFLQLKSQEEVTAALVSPKVGTLAHNKDLVEYWRQKSSSSRSLPPNLKPILYEEPKIHP
HLQFFLLRLSIALEKEKGELGNAGTVKDLEDMLARVTTFLAVRQMQSMFSGQETSIPKAP
LMRTIQDWLRKKGHGDPDVPVATSVTEHPAEICRLCQGSIEFDDVRAATCENGHSWERCC
LTFAACQVVPYRKCRLCGAAALPKPARGSREVCPELLMSNSCTFCSGDLL
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggaaggttcaaatggttctaatgtgacagtggccaatcaagctactggtataagttta
cacccacaagttgtaccactaaaccacgaaacctgcagtgtcgacattattgactggtcc
gacgacaatcgtattgccgtggcaaccaaaaagggcgtgtactgcctgaacttcttgtcc
tcagctgaccttgttgacgagaactttaggatgcaaagaacgttccttgagctctctaca
aagaaggctgttagtggaactaacctgtcgcaagaatatatgcatgggcaggtcatcgcc
ttagagaatggctaccgggccgttcgctggtcgcccttagagtgcggcgcggacggaagg
tgcttgttaatgaccttgaccttggaccacagtttagctgttcacttttcgcagcaaagc
cagctacactggcaagagattttagacttctccgaactagaatcaagccacaaagagact
gcaaagtctggtaagagatcgcctaaactctttgcaacagacatgcagtggtcagagact
ttttgcaaggcgtgtgatacaggggatggatttgaacttgacagacacgtcatgctagca
gtggccacaaacagtggccaggttgttctgtgggagtttaaatgtcccattgtagaccgc
acaagtgccgtgggccgccaactgatcgaaacaacttcagaatgtatcacatgcctggct
tgggtgcaggaacagaataatccaccagggggcattgcttttggccacctggatgggaca
atctccatatggcctacaggagtggatacagggtcaacgaccttcctgacaacacctaca
gtgttgtggaaagagaaggatctgctagccgtaacatctgtgaaatcgaggcctttagaa
aagaatggaagtatccttgtggcaagcaaagggcccaatgtgatgtgctttgagatagag
aagtcaggggacaacatcacgcttttacatacagtgtggacagatgccattcattctatg
cctattttggggctagctttgagtacagaacacaagatatacacttgttgcatgggcagt
gcaattacagtcactaacatcaagagaaacaaatcaggcttgtctttagaagcattccca
atcgataccaactcatctctgcttaagcgtggttacggtgtagcgctttcaagaaactct
gtgtttctgggatgcgtatctggactaaccgataccctgaatggcgtggtgaaacttcag
gtgaactttctacagttgaagtctcaggaagaagtaacagcagctttggtatcaccaaag
gttgggactctggctcacaacaaagacttggtagagtactggagacagaagtcatcgtcc
tcaaggtcgttgccccccaatctgaagcccatactgtatgaggagccaaaaatacatcca
catcttcaatttttcctgttgagactctccattgcactggagaaagagaagggtgaactc
ggcaatgcaggaactgtgaaagatttggaagacatgctagcaagagtgaccacctttttg
gctgtgagacagatgcagagtatgttcagtggacaggaaacaagcattcccaaggcacca
ctgatgagaacaattcaagattggctgaggaaaaagggccatggtgaccctgacgttcca
gtggctacgtcggtaacagaacacccagcggaaatatgcagattatgtcaggggtcaatc
gaatttgacgacgtcagagcggcaacgtgcgaaaatggccactcatgggaacgctgctgt
ctgacatttgccgcctgtcaagttgttccctacaggaagtgtaggctgtgtggtgctgca
gctcttcctaaacctgctagggggagtcgagaagtttgtccagaactgctcatgagcaat
agttgtactttctgtagtggagaccttctgtga

DBGET integrated database retrieval system