KEGG   Bacteroides fragilis YCH46: BF0059Help
Entry
BF0059            CDS       T00202                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BF0059
Enzymes [BR:bfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BF0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
63355..63816
Genome map
AA seq 153 aa AA seqDB search
MKVYLGLGTNLGDKELNLRVALQKIEERIGKIISLSAFYATAPWGFQSENNFLNAAVGVE
TVLSPVGILESTQRIEQEIGRLHKSRDGVYSDRLIDIDLLLYGDKILQDERLIVPHPLMT
DRKFVLEPLAEIAPDVVHPVFHKTIKELFLALS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatatttgggattaggtaccaacttgggtgataaggagctaaatcttcgtgtt
gccctacaaaaaatagaggagcggatagggaaaatcatttctctttccgctttttatgct
actgctccctggggatttcagtcggaaaacaactttctgaatgctgcggtgggagtggag
acagtattgtcccctgtcgggatactggaaagtactcaacggatagagcaggaaataggg
cgtttgcataaatcacgggacggtgtgtatagtgaccgcctgattgacattgatcttttg
ctctatggcgataagatactacaggatgaaaggcttatagtgcctcatccgttgatgacc
gaccgtaagtttgttctggaaccccttgccgagattgcaccggacgttgttcatccggtg
tttcataagacgattaaagagctatttctggctctttcgtga

DBGET integrated database retrieval system