KEGG   Bacteroides fragilis YCH46: BF0064Help
Entry
BF0064            CDS       T00202                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BF0064
Enzymes [BR:bfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BF0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67306..67803
Genome map
AA seq 165 aa AA seqDB search
MKYFCVTEAVALYIQKYVQYRKRKIFFGATGKIEDLIPSIVKHKTEKYLVPMSDVHNDDV
RDLLDKNNIQHTECVMYRTVSNDFMEGEEFDYDMLVFFSPAGVSSLKKNFPDFDQKDIKI
GTFGSTTAQAVRDAGLRLDLEAPNVKAPSMTAALDLFIKENNKGK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttctgtgtaacagaagctgttgctctttatattcagaagtatgtgcagtat
cgtaagcgtaagatcttctttggtgctacgggcaagatcgaggatctgattccttcgatt
gtgaaacataaaacagaaaagtatctcgtcccgatgtcggatgtacacaacgatgacgtg
agggatctgctggataaaaataacatccagcatacggaatgcgtaatgtatcgcactgtt
agcaatgactttatggagggagaggagtttgattatgatatgttggtattctttagtcct
gccggagtatcttcgctgaagaagaacttccctgattttgatcagaaggacattaagatc
ggaacattcggatcgactacagcacaagctgttcgtgatgccggactccgtcttgatctt
gaagcacctaacgtgaaagctccttcaatgacggctgccctcgatttgtttattaaggaa
aacaataaaggaaaataa

DBGET integrated database retrieval system