KEGG   Bacteroides fragilis YCH46: BF0217Help
Entry
BF0217            CDS       T00202                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF0217
   01230 Biosynthesis of amino acids
    BF0217
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF0217
   00030 Pentose phosphate pathway
    BF0217
   00051 Fructose and mannose metabolism
    BF0217
   00052 Galactose metabolism
    BF0217
  Energy metabolism
   00680 Methane metabolism
    BF0217
Enzymes [BR:bfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BF0217
Protein phosphatases and associated proteins [BR:bfr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BF0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
239748..240758
Genome map
AA seq 336 aa AA seqDB search
MKIGILTSGGDCPGINATIRGVCKTAINYYGMEVVGIHSGFQGLLTKEVESFTEKSLSGL
LNLGGTMLGTSREKPFRKQGIISDVDKPALIQRNIAELGLDCVVCIGGNGTQKTAAKFAA
MGINIVSVPKTIDNDIWGTDISFGFDSAVSIATDAIDRLHSTASSHKRVMVIEVMGHKAG
WIALYSGMAGGGDVILVPEIPYNIKNIGDTILNRLKKGKPYSIVVVAEGIQTDGRKRAAE
YIAQEIEYETGIETRETVLGYIQRGGSPTPFDRNLSTRMGGHATELIANGQFGRMIALKG
DEISSVALEEVAGKLKLVTEEHDLVVQGRRMGICFG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggaattcttacatcaggcggcgattgccccggtataaacgctacaattcgt
ggggtatgcaaaacagctattaattattacgggatggaagttgtagggattcacagtggt
tttcagggactgttgacgaaagaagtagaatcgtttactgaaaaatctttgtccggattg
ttgaatttgggcggtaccatgctgggaacttcgcgggagaaaccgtttcgtaagcaaggc
attatctcggatgtagataaacctgcgttaatacaacgtaatattgcagaattgggtctt
gattgtgtagtgtgtatcggggggaatggtacacagaaaaccgctgcaaagtttgctgcg
atgggaatcaatattgtttctgtgcccaaaacgatcgataacgatatctggggtaccgat
atctctttcggattcgactcggcagtgagtattgctacggatgctattgaccggcttcat
tccacggcgagttcgcacaaaagggtgatggtgatcgaggtgatgggacataaagccggt
tggattgctttatattcgggcatggcaggtggaggcgatgttattctggtaccggagata
ccttacaatattaaaaatataggagatacgattttaaatcgcttgaagaaaggaaaaccc
tattcgattgtagtggttgccgagggcatccagaccgatggacgtaaacgtgctgccgaa
tatattgctcaggagattgaatatgaaacgggtattgagacacgtgaaactgtattaggt
tatattcagcgtggtgggtcgcctacacctttcgaccgtaacttgtctacccgtatggga
ggacatgcaacagaactgatcgctaatggacagttcggtcgtatgattgctttgaaaggg
gatgagatatcttctgttgcattagaggaggtagccggaaagttgaaattggtgaccgag
gaacacgatcttgtggtgcagggacgccggatgggaatctgctttggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system