KEGG   Bacteroides fragilis YCH46: BF0253Help
Entry
BF0253            CDS       T00202                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BF0253
Enzymes [BR:bfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     BF0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274901..276673
Genome map
AA seq 590 aa AA seqDB search
MKKYPKIGIRPTIDGRQGGVRESLEEKTMNLAKAVAELITSNLKNGDGTPVECVIADGTI
GRVAESAACAEKFEREGVGATITVTSCWCYGAETMDMNPYYPKAVWGFNGTERPGAVYLA
AVLAGHAQKGLPAFGIYGRDVQDLNDNSIPADVAEKILRFARAAQAVATMRGKSYLSMGS
VSMGIAGSIVNPDFFQEYLGMRNESIDLTEIIRRMAEGIYDKEEYAKAMAWTEKYCKKNE
GNDFNIPEKTKTRAQKDEDWEFIVKMTIIMRDLMQGNPKLKELGFKEEALGHNAIAAGFQ
GQRQWTDFYPNGDFSEALLNTSFDWNGIREAFVVATENDACNGVAMLFGHLLTNRAQIFS
DVRTYWSPEAVKRVTGKELTGMAANGIIHLINSGATTLDGTGQQTNANGEPAMKPCWEIT
EGEVEKCLEATTWYPANRDYFRGGGFSSNFLSKGGMPVTMMRLNLIKGLGPVLQIAEGWT
VEIDPEIHKLLDERTDRTWPTTWFVPRLCDKPAFKDVYSVMNNWGANHGAISYGHIGQDV
ITLASMLRIPVCMHNVEEDQIFRPAAWNAFGMDKEGADYRACTTYGPIYK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtatccaaaaatcgggattcgtcccaccatcgatggacgtcagggcggcgtt
cgcgaaagccttgaagaaaaaacaatgaatctggcaaaagctgttgccgagttgatcact
tctaatttgaagaatggagacggaacccctgtggagtgtgtgattgcagatggaaccatc
ggacgtgtggctgaaagtgctgcttgtgcggagaagtttgaacgtgagggggtaggagcc
actatcactgtcacttcatgctggtgttacggtgccgaaacaatggatatgaatccgtat
tatccgaaagctgtttggggatttaatggaacagagcgtccgggagctgtatatctggct
gctgtgctggcaggacatgcacagaaaggacttccggcatttggcatttatggtcgcgat
gtacaagacttgaatgacaattctattccggcagatgtagctgaaaaaattctgcgtttt
gcacgtgcggctcaggctgtagccacaatgcgtggcaaatcttatctgtctatgggcagt
gtttctatgggtattgccggttcgattgtaaacccggactttttccaggaatatctgggc
atgcgtaatgaatcgattgatttgacagagattattcgtcgtatggccgaaggaatctat
gataaggaagagtatgccaaggcaatggcttggactgaaaaatattgcaaaaagaatgag
ggcaatgactttaatatacctgaaaaaacgaagacccgtgcacaaaaagatgaggactgg
gagttcattgtgaaaatgacaatcatcatgcgcgatctgatgcagggaaaccctaaattg
aaagaactcggatttaaggaagaggctttggggcataatgctattgcggcaggtttccaa
gggcagcgtcagtggaccgatttctatccgaatggcgacttctctgaagcattactcaat
acttcgttcgattggaatggtattcgtgaggcttttgtcgttgcaacagaaaacgatgct
tgtaacggtgtggctatgctgtttggtcatctgctgacgaatcgtgcacagattttttca
gatgtacgcacatattggagtccggaagcagtgaaacgtgtgaccggtaaagagttgaca
ggaatggctgctaacggtattattcacttgattaattcgggggcaactactcttgacgga
accggacagcagacgaatgctaacggagaacctgcgatgaaaccttgctgggaaattaca
gaaggagaagttgagaagtgtctggaggctactacctggtatccggctaatcgcgattat
ttccgtggaggtggtttctcttccaatttcttatcaaaaggaggtatgcctgtaactatg
atgcggttgaacctgataaaaggtcttggtccagtgctgcagatagccgaaggctggaca
gtagagattgatccggagattcataaattacttgacgaacgtacggatcgtacatggcct
actacctggtttgttcctcgtttgtgtgataaaccggcctttaaagatgtatattctgtg
atgaataactggggggccaatcatggggcgatcagttatggacatattgggcaggatgtg
attacattggcttccatgcttcgtattccggtttgcatgcataatgtagaagaagaccag
attttccgtccggcagcttggaatgcttttggtatggataaagaaggagcagattataga
gcttgtactacttatggtcctatttataaataa

DBGET integrated database retrieval system