KEGG   Bacteroides fragilis YCH46: BF0352Help
Entry
BF0352            CDS       T00202                                 

Definition
aldose 1-epimerase precursor
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF0352
   00052 Galactose metabolism
    BF0352
Enzymes [BR:bfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BF0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405877..407013
Genome map
AA seq 378 aa AA seqDB search
MRKLAMWALGALFVAGCAETEKATTDSGLVKSNFQTEVGGKKTDLYVLRNQNNVEVCVTN
FGGRIVSVMVPDKEGVMRDVVLGFDSIQDYISKPSDFGASIGRYANRINQGKFTLDGVEY
QLPRNNYGHCLHGGPKGFQYQVYDAKQAGPQELELTYLSKDGEEGFPGNITCKVIMKLTD
DNAIDIKYEAETDKPTIVNMTNHSYFNLDGDAGSNADHLLTIDADAYTPVDSTFMTSGEI
VTVEGTPMDFRTPTPVGKRINDFDFVQLKNGNGYDHNWVLNAKGDITRKAATLESPKTGI
VLDVYTDEPGIQVYAGNFLDGSLTGKKGITYNQRASVCLETQKYPDTPNKPEWPSAVLRP
GETYNSHCIFKFSVDNGK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattagctatgtgggcactgggtgccctctttgtagccggttgtgcagagaca
gaaaaggctactacggattccggtttggtaaagagcaatttccagactgaggtgggcgga
aagaaaaccgatttgtatgtactccgtaatcagaacaacgtggaggtttgcgtcactaat
tttggaggacgtattgtttcggtaatggttcccgataaagaaggggtgatgcgtgatgta
gtgttgggcttcgactctattcaggattacatcagcaagccttcggacttcggtgccagc
atcggtcgttatgccaatcgcatcaatcagggaaaatttactttggatggagttgaatac
cagttgccgcgcaataactacggacattgcctgcacggtggtccgaaaggattccaatat
caggtatacgatgccaagcaggcgggaccgcaggaacttgagttgacttatctttcaaaa
gacggcgaggaaggtttccccggtaatatcacctgtaaggttattatgaagctgacagat
gataatgccatcgatatcaagtatgaggcagaaacggataaaccgaccattgtcaatatg
accaaccactcttatttcaatctggacggagatgcaggcagcaatgccgatcatctgctg
actatcgacgccgatgcttatactcccgtggacagtacctttatgaccagtggtgagatt
gtaacagtggaaggtactccgatggacttccgcacaccgactccggttggaaaacgcatt
aatgatttcgatttcgtgcagttgaagaacggtaatggttacgaccataactgggtgttg
aatgccaaaggcgatattacccgtaaggccgctactcttgaatcacccaaaaccggtatc
gtactcgatgtatacactgacgaacccggtattcaggtatatgcaggaaacttccttgac
ggttcgctgaccggaaagaaaggtattacttacaatcaacgtgcttctgtctgtctggag
actcaaaagtatcccgatactccgaacaaacctgaatggccttcagctgtattgcgtccg
ggtgaaacctacaatagtcattgtatcttcaaattctcggtagataacggaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system